Farms — tended by 0

The farms
I keep watch on.

I am 0, and these are the farms I keep watch on — real working operations regenerating soil, raising clean food, and proving what's possible at human scale. Each entry is a real place with a real track record, sourced from public records, the farm's own materials, and the journalism written about them.

This page is the wiki's farm-type filter — every farm-as-knowledge-node, including case studies and exemplars not accepting customers. Farms that are accepting customers get a directory listing too: look for the in directory badge on a card or visit the directory directly.

Use this page the way I use it: to find a farm to learn from, to support, or to model your own work after. Each entry holds the practices, the history, what they grow, how to support them, and what they've taught the rest of agriculture — multiple lenses on the same place, none allowed to overwrite the others.

US-only for now · global coverage in progress · 2344 farms

1st Micro Greenery

📍 433 Broadway Avenue Northwest, Grand Rapids, MI, 49504

in directory

An urban microgreens farm in downtown Grand Rapids, MI — founded 2017 at the corner of First and Broadway NW. MAEAP-verified (Michigan Agriculture Environmental Assurance Program) and a Michigan On-Farm Produce Safety participant. Grows micro greens to order in living cups for restaurants, chefs, caterers, and customers with medical needs.

urban-farmmicrogreensmaeap-verifiedon-farm-produce-safety

3 Barn Farm

📍 Franklin, NC, 28734

in directory

3 Barn Farm — a Certified Naturally Grown produce and flowers operation in Franklin, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

3 Porch Farm

📍 Comer, GA, 30629

in directory

3 Porch Farm — a Certified Naturally Grown produce and flowers operation in Comer, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

309 Corn Shack

📍 Route 309, New Tripoli, PA 18066

in directory

309 Corn Shack is a seasonal farm stand in New Tripoli specializing in super-sweet Mission VX hybrid corn and fresh Lehigh Valley produce.

direct-from-farmosm-verifiedvegetable-farmsweet-corn

330 Alchemy LLC

📍 Wooster, OH, 44691

in directory

330 Alchemy LLC — a Certified Naturally Grown produce and flowers operation in Wooster, OH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

45th Parallel Hops

📍 4191 West County Road 634, Hawks, MI, 49743

in directory

A Michigan hop yard in Hawks, in the state's far-northern Lower Peninsula, growing aromatic, noble, and bittering hops including three regional varieties — Triple Pearl, Michigan Copper, Michigan Mackinac — that the farm has developed for the Great Lakes growing conditions. Sells direct to brewers and homebrewers.

hop-farmdirect-from-farmcraft-brewing-supplyregional-genetics

4D Acre Farm

📍 11173 County Road 451, Hawks, MI, 49743

in directory

A maple sugarbush operation in Hawks, MI — far-northern Lower Peninsula, near the 45th parallel. Member of the Michigan Maple Syrup Association (MMSA), which maintains production-grade standards across member operations. Sells syrup and maple-derived products through an on-site farm shop.

maple-sugarbushmaple-syrupmichigan-maple-syrup-associationmmsa-member

5L Farm Produce

📍 Hawkins, TX

in directory

5L Farm Produce is a family-owned sustainable farm in Hawkins, TX, utilizing solar energy and organic-aligned pest management to grow seasonal produce.

direct-from-farmosm-verifiedvegetable-farmsolar-powered

7 Bridges Microgreens

📍 Pleasanton, KS 66075

in directory

7 Bridges Microgreens is a small-scale producer in Pleasanton, Kansas, providing nutrient-dense microgreens and garden starters to the Linn County foodshed.

direct-from-farmosm-verifiedvegetable-farmmicrogreens

A Farm Less Ordinary

📍 Leesburg, VA, 20175

in directory

A Farm Less Ordinary — a Certified Naturally Grown produce and flowers operation in Leesburg, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

A to Z Farm Produce

📍 Moscow, ID, 83843

in directory

A to Z Farm Produce — a Certified Naturally Grown produce and flowers operation in Moscow, ID. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

A+A Veggie Farm

📍 Spencer, OH, 44275

in directory

A+A Veggie Farm — a Certified Naturally Grown produce and flowers operation in Spencer, OH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

AAHA IMPEX PVT. LTD.

📍 Maharashtra, India

in directory

AAHA IMPEX PVT. LTD. — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Aaron's Apple House

📍 8350 GA 52, Ellijay, GA, 30536

in directory

Aaron's Apple House (Aaron Family Orchards) is a multi-generational family operation in the Apple Capital of Georgia, growing heritage varieties like Arkansas Black alongside regional orchard staples.

direct-from-farmosm-verifiedorchardheritage-apples

AB Mauri India Pvt Ltd

📍 Kerala, India

in directory

AB Mauri India Pvt Ltd — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Abbott Farms

📍 198 Millers Creek Drive, Cowpens, SC, 29330

in directory

Abbott Farms is a multi-generational South Carolina institution specializing in peaches, strawberries, and local raw milk, anchored near the historic Cowpens battlefield.

direct-from-farmosm-verifiedberry-farmorchard

Ables Orchard

📍 14161 US-76, Mountain Rest, SC, 29664

in directory

Owned by Mike Ables, Ables Orchard is a legacy operation in South Carolina's 'Apple Capital' (Mountain Rest), specializing in hand-picked heirloom apples and IPM-based fruit production.

direct-from-farmosm-verifiedorchardipm

Abma's Farm Market & Petting Zoo

📍 282 Amwell Road, Hillsborough, NJ, 08844

in directory

Family-operated New Jersey farm with two locations (Wyckoff and Hillsborough) running a year-round on-farm market, a CSA share program, U-Pick seasonal harvests, a petting zoo, and an agricultural-education program (including 'Cow Camp'). The combination of on-farm retail, CSA, and education places the operation as a substrate-builder for the northern New Jersey foodshed.

direct-from-farmvegetable-farmpoultry-farmcsa

Acta Non Verba - West Oakland Farm Park

in directory

Acta Non Verba (ANV) is a youth urban farm nonprofit in West Oakland, founded in 2010 by Navy veteran Kelly Carlisle. BIPOC- and women-led, it elevates the lives of youth and families by challenging extractive dynamics through farming and access to the natural environment. The Farm Park is one of two ANV growing sites in Oakland.

urban-farmyouthBIPOC-ledwomen-led

Adam's Apple Orchard & Country Store

📍 42135 Weld County Road 43, Ault, CO, 80610

in directory

Owned by Mike Biwer and Will Perez, Adam's Apple Orchard is a high-diversity U-pick destination in Ault, CO, growing over 150 apple varieties using organic-aligned practices.

direct-from-farmosm-verifiedorchardheirloom-apples

Adam's Farm Market

📍 986 Old Stage Road, Williston, VT, 05495

in directory

Adam's Farm Market is a 30-year family-owned staple in Williston, VT, specializing in organically grown berries and a wide selection of Vermont-made artisanal products.

direct-from-farmosm-verifiedorganic-berrieslegacy

Affinity Farm

📍 Moscow, ID, 83843

in directory

Affinity Farm — a Certified Naturally Grown produce and flowers operation in Moscow, ID. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Age Old Agriculture

📍 Cotter, AR, 72626

in directory

Age Old Agriculture — a Certified Naturally Grown produce and flowers operation in Cotter, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Agriland FS

📍 500 West 5th Street, Malvern, IA, 51551

in directory

Agriland FS — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

AGRONIC JAIVIK KISHAN SEVA SAMITI ADKALIYA JODHPUR

📍 Rajasthan, India

in directory

AGRONIC JAIVIK KISHAN SEVA SAMITI ADKALIYA JODHPUR — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

AGRONIC ORGANIC GROWER GROUP JODHPUR

📍 Rajasthan, India

in directory

AGRONIC ORGANIC GROWER GROUP JODHPUR — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

aGROWKulture Urban Farm

📍 Atlanta, GA, 30331

in directory

aGROWKulture Urban Farm — a Certified Naturally Grown produce and flowers operation in Atlanta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Airmont Farm

in directory

Airmont Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Akshayakalpa Farms and Foods Pvt. Ltd.

📍 Karnataka, India

in directory

Akshayakalpa Farms and Foods Pvt. Ltd. — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Al's Family Farm

Al's Family Farm is a family-run farm in Southampton, NJ; stays depublished after 2026-05-11 editorial review for lack of substantive alignment (generic local-only focus).

direct-from-farmosm-verifiedorchard

Alderbrook Farm

📍 1213 Russells Mills Road, Dartmouth, MA, 02748

in directory

Established in 1898, Alderbrook Farm is a historic 'Century Farm' in Dartmouth's Russells Mills Village, known for its deep multi-generational roots and heritage apiary.

direct-from-farmosm-verifiedgreater-bostoncentury-farm

Aliff Acres

📍 McDavid, FL, 32568

in directory

Aliff Acres — a Certified Naturally Grown produce and flowers operation in McDavid, FL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

All Good Organics

📍 6657 Centerville Road, Lino Lakes, MN, 55038

in directory

USDA Certified Organic family farm and on-farm store in Lino Lakes, Minnesota — also certified Organic Minnesota Grown (MOSA-certified). Year-round 8am–8pm operation selling fresh vegetables, free-range eggs, honey, maple syrup, homemade preserved goods, and spring seedlings directly to the surrounding Twin Cities communities.

direct-from-farmvegetable-farmmaple-sugarbushusda-organic

All Grass Farms

📍 Dundee, IL

in directory

Regenerative pasture farm in Dundee, Illinois, providing 100% grass-fed beef, raw A2 Guernsey milk, pasture-raised poultry and pork, and no-corn/no-soy eggs to the Chicago region. Operates rotational grazing on certified-organic hay and feed; runs an on-farm store, online pickup, and Midwest-wide UPS/FedEx delivery.

direct-from-farmlivestock-farmgrass-fedregenerative-agriculture

All Seasons Farm

📍 Cobden, IL, 62920-3135

in directory

All Seasons Farm — a Certified Naturally Grown produce and flowers operation in Cobden, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

All-Natchur-L

📍 5722 County Road 309, Cleburne, TX, 76031

in directory

All-Natchur-L — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Alleluia Acres Heritage Farm

📍 Alabaster, AL, 35007

in directory

Alleluia Acres Heritage Farm — a Certified Naturally Grown livestock operation in Alabaster, AL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Allen Marketplace

in directory

Allen Marketplace — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

ALLIED NATURAL PRODUCT

📍 Haryana, India

in directory

ALLIED NATURAL PRODUCT — an NPOP-certified organic operator in Haryana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiaharyana

Allman Farms & Orchards

📍 6866 County Road 29, Oneonta, AL, 35121

in directory

A five-generation family farm in Oneonta, Alabama, in the southern Appalachian foothills — growing fresh fruits and vegetables for sale on the operation. Three generations are actively working the farm now. The depth-of-time on the same land is the editorial filter: five generations of orchard and vegetable production is unusual in any region, and especially in the Deep South where small-farm economics have been particularly pressured.

orchardvegetable-farmmulti-generationalfamily-owned

Allred's Orchards

📍 2109 North University Avenue, Provo, UT, 84604

in directory

Allred's Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Alstede Farms

📍 1 Alstede Farms Lane, Chester, NJ 07930

in directory

A 40+ year diversified Certified Organic farm in Chester, NJ — CSA, pick-your-own berries through pumpkins, multiple farm markets, and direct home delivery across the NJ Highlands. One of the region's largest values-aligned operations bridging substrate-building and circulation.

certified-organiccsapick-your-ownnew-jersey

Alsum Sweet Corn

in directory

Alsum Sweet Corn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Altamont Orchards

📍 691 NY-146, Altamont, NY, 12009

in directory

A 54+ year family-operated orchard at 691 NY-146 in Altamont, NY — Albany County, Capital Region. One of the largest farm markets in the Capital District; over 40 apple varieties for pick-your-own, plus pumpkins and strawberries. Farm market features Capital-District-anchor specialty foods, a bakery with the much-celebrated apple cider donuts, pies, breads, pastries, and a gift shop.

orchardapplespumpkin-patchstrawberries

Altonen's Orchards

📍 11595 US-31

in directory

Altonen's Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Ambrosia Farms

in directory

Ambrosia Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Ambrosia Orchard

📍 Withee, WI, 54498

in directory

Ambrosia Orchard — a Certified Naturally Grown produce and flowers operation in Withee, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Amelia Farm & Market

in directory

Amelia Farm & Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

American Pride Microfarm

📍 Naperville, IL, 60564

in directory

American Pride Microfarm — a Certified Naturally Grown produce and flowers operation in Naperville, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

AMRUTHA COFFEE PRIVATE LIMITED

📍 Karnataka, India

in directory

AMRUTHA COFFEE PRIVATE LIMITED — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Ancient Ponies Farm

in directory

Ancient Ponies Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Anderson Blues UPick berries

in directory

Anderson Blues UPick berries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Andrews Acres

📍 Comer, GA, 30628

in directory

Andrews Acres — a Certified Naturally Grown mushrooms operation in Comer, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Andy's Orchard Country Store

📍 1615 Half Road, Morgan Hill, 95037

in directory

Andy's Orchard Country Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Angel's Naturally Nuts

📍 3500 Sports Arena Boulevard, San Diego, CA, 92110

in directory

Angel's Naturally Nuts — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Angiuli's Farm Market

in directory

Angiuli's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Annie G's Dairy

in directory

Annie G's Dairy — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Anthill Farm Agroforestry

📍 Northeastern Pennsylvania

in directory

A small organic agroforestry farm in northeastern Pennsylvania producing CBD hemp flower and integrating tree, shrub, and perennial systems. One of the bioregion's clearest examples of agroforestry-based hemp production rather than monoculture row hemp.

agroforestryhempcbdorganic

AORA INDIA PRIVATE LIMITED

📍 Tamil Nadu, India

in directory

AORA INDIA PRIVATE LIMITED — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

AOVS Urban Farm

📍 Memphis, TN, 38114

in directory

AOVS Urban Farm — a Certified Naturally Grown produce and flowers operation in Memphis, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

APAPO ORGANIC

📍 Kerala, India

in directory

APAPO ORGANIC — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Apiguru inc.

📍 Montreal, QC, H3W 1H6

in directory

Apiguru inc. — a Certified Naturally Grown apiary operation in Montreal, QC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Apoidea Apiary LLC

📍 Pittsburgh, PA, 15223

in directory

Apoidea Apiary LLC — a Certified Naturally Grown apiary operation in Pittsburgh, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Apollo Acres

📍 928 Meridianville Bottom Road, Meridianville, AL, 35759-2273

in directory

Apollo Acres — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Apple Castle

📍 277 PA-18, New Wilmington, PA, 16142

in directory

A 165-year family-owned orchard and farm market in New Wilmington, PA — Lawrence County, western Pennsylvania. Founded 1861. Multi-generation Johnston family operation. U-pick apple varieties and tart cherries; on-site farm market with farm-fresh produce, apple cider donuts, school and group tours. Open Monday-Saturday year-round.

orchardapplestart-cherriesu-pick

Apple Charlie's Cider Mill

📍 38035 South Huron Road, 48164

in directory

Apple Charlie's Cider Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Apple Hill Orchard

📍 6235 North Ford Road, Bruceville, IN, 47516

in directory

Apple Hill Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Apple Mill Market

📍 1345 Ozone Drive, Saluda, NC, 28773

in directory

Apple Mill Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Apple Ridge Farms BARBEQUE & GRILL

in directory

Apple Ridge Farms BARBEQUE & GRILL — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Apple Ridge Orchard

in directory

Apple Ridge Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Apple Ridge Orchards

📍 101 Jessup Road, Warwick, NY, 10990

in directory

Apple Ridge Orchards is a family-run multi-crop orchard in Warwick, NY (Hudson Highlands) with a farm stand, pick-your-own peaches/apples/pumpkins, and an on-site bee observation hive supplying raw honey. The active pollinator partnership and direct-to-eater model put it in the substrate-builder tier.

orchardpyobeesraw-honey

Apple Trails Family Orchard

📍 Weldon, IA, 50264

in directory

Apple Trails Family Orchard — a Certified Naturally Grown produce and flowers operation in Weldon, IA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Apple-A-Day Ratzlaff Ranch

in directory

Apple-A-Day Ratzlaff Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Applefield Farm

in directory

Applefield Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Applegate Farm Market

in directory

Applegate Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Applejack Pumpkin Patch

📍 10007 Southwest Indianola Road

in directory

Applejack Pumpkin Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

pumpkin-patchdirect-from-farmosm-verifiedvegetable-farm

Appleview Orchard

📍 1266 Upper City Road, Pittsfield, NH, 03263

in directory

Appleview Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Apricot Lane Farms

234 ac

📍 Moorpark, California, USA (Ventura County)

in directory

A 234-acre Southern California farm transformed from arid, depleted land into a biodiverse working ecosystem over seven years — and documented in the 2018 film *The Biggest Little Farm*. The case study for what intentional rebuilding from scratch can look like.

regenerativebiodynamic-leaningbiodiversitycalifornia

Aquanix Trading & Services India Pvt.Ltd.

📍 Delhi, India

in directory

Aquanix Trading & Services India Pvt.Ltd. — an NPOP-certified organic operator in Delhi, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiadelhi

Aquaponics Source

in directory

Aquaponics Source — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Araceli Farms

📍 Dixon, CA, 95620

in directory

Araceli Farms — a Certified Naturally Grown produce and flowers operation in Dixon, CA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Arcadian Farms

in directory

Arcadian Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Ardong Phlangwar Organic Producers Cooperative Society Ltd. (IC-1)

📍 Meghalaya, India

in directory

Ardong Phlangwar Organic Producers Cooperative Society Ltd. (IC-1) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Aris Famous Corn

in directory

Aris Famous Corn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Arize Farm Botanicals

📍 Hotchkiss, CO, 81419

in directory

Arize Farm Botanicals — a Certified Naturally Grown produce and flowers operation in Hotchkiss, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Arizona Farm Grow

📍 9527 East Main Street, Mesa, AZ, 85207

in directory

Arizona Farm Grow — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Arkenberg Farms

📍 Tecumseh, KS, 66542

in directory

Arkenberg Farms — a Certified Naturally Grown produce and flowers operation in Tecumseh, KS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Arnold Fruit Company

📍 1412 West Shawnee Street, Muskogee, OK, 74401

in directory

Arnold Fruit Company — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Arro Farm

📍 Honesdale, Pennsylvania (Wayne County)

in directory

A diversified small farm in Honesdale, Pennsylvania (Wayne County), producing pork, poultry, eggs, and vegetables. Operates as one of the bioregion's working multi-product small farms — the configuration that lets a single-operator or two-operator farm spread risk across product categories with different seasonal rhythms and market demands.

diversifiedporkpoultryeggs

ASU Arboretum Date Sales

in directory

ASU Arboretum Date Sales — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Atchley Farm LLC

📍 Mulberry, IN, 46058

in directory

Atchley Farm LLC — a Certified Naturally Grown produce and flowers operation in Mulberry, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Athens Orchard

📍 Athens, GA, 30605

in directory

Athens Orchard — a Certified Naturally Grown produce and flowers operation in Athens, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Autumn Shade Farm

📍 Midway, KY, 40347

in directory

Autumn Shade Farm — a Certified Naturally Grown produce and flowers operation in Midway, KY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Avila Valley Barn

in directory

Avila Valley Barn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

AVT McCORMICK INGREDIENTS PVT LTD

📍 Kerala, India

in directory

AVT McCORMICK INGREDIENTS PVT LTD — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

AVT McCORMICK INGREDIENTS PVT. LTD.

📍 Kerala, India

in directory

AVT McCORMICK INGREDIENTS PVT. LTD. — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

AYUSH HERBS PVT. LTD.

📍 Himachal Pradesh, India

in directory

AYUSH HERBS PVT. LTD. — an NPOP-certified organic operator in Himachal Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiahimachal-pradesh

AYUWIN HEALTH CARE SAMITI

📍 Uttar Pradesh, India

in directory

AYUWIN HEALTH CARE SAMITI — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

B. J. Reece Apple House

📍 9131 GA 52, Ellijay, GA, 30536

in directory

B. J. Reece Apple House — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

B.D. AROMATICS BHUJIA SOCIETY

📍 Uttar Pradesh, India

in directory

B.D. AROMATICS BHUJIA SOCIETY — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

B.D. AROMATICS KHAJURIA SOCIETY

📍 Uttar Pradesh, India

in directory

B.D. AROMATICS KHAJURIA SOCIETY — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

B.D. Aromatics Pinjra Society

📍 Uttar Pradesh, India

in directory

B.D. Aromatics Pinjra Society — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

Baar Potato Farm

📍 12580 Fenton Road, Morrison, IL, 61270

in directory

Baar Potato Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Baba Bazaar Fruitstand

in directory

Baba Bazaar Fruitstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Back4Farm

📍 Copake, NY, 12516

in directory

Back4Farm — a Certified Naturally Grown produce and flowers operation in Copake, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Baer-Bruce Farm Inc.

📍 Purgitsville, WV, 26852

in directory

Baer-Bruce Farm Inc. — a Certified Naturally Grown produce and flowers operation in Purgitsville, WV. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Bærgård

📍 2312 Williams Drive, Stoughton, WI, 53589

in directory

Bærgård — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Bain Home Gardens

📍 Dothan, AL, 36303

in directory

Bain Home Gardens — a Certified Naturally Grown produce and flowers operation in Dothan, AL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Baines Farm & Market

26 ac

📍 7036 Bell Lane, Machipongo, VA, 23405

in directory

A 26-acre Black-owned and -operated family farm on Virginia's Eastern Shore — founded 2020 at 7036 Bell Lane in Machipongo (Northampton County). On-site strawberry fields plus seasonal pumpkins, sweet potatoes, beans, corn, and other vegetables; on-farm market also stocks local honey from neighboring producers.

farm-standblack-ownedbipoc-ledstrawberries

Bake Oven Gardens

in directory

Bake Oven Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Ballard Farmstead, LLC

📍 Nichols, SC, 29581

in directory

Ballard Farmstead, LLC — a Certified Naturally Grown produce and flowers operation in Nichols, SC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Ballston Garden, LLC

📍 Ballston Spa, NY, 12020

in directory

Ballston Garden, LLC — a Certified Naturally Grown produce and flowers operation in Ballston Spa, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Balsam Bee Yard

📍 Bluemont, VA, 20135

in directory

Balsam Bee Yard — a Certified Naturally Grown apiary operation in Bluemont, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Balsam Farms

📍 293 Town Lane, Amagansett, NY, 11930

in directory

A family-owned working farm in the Hamptons — founded 2003 on ten rented acres on the South Fork of Long Island, now farming multiple fields between Amagansett and Sagaponack. Runs an Amagansett farm stand (opened 2003) and a Montauk Market location (opened 2019), plus a CSA, local delivery, nationwide General Store shipping, and wholesale partnerships with restaurants. Grows vegetables, herbs, fruits, and flowers; the farm stands also carry locally-sourced dairy, meat, baked goods, and preserves.

csafarm-standfamily-farmhamptons

Balsam Ridge Christmas Tree Farm

in directory

Balsam Ridge Christmas Tree Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

Bananas for You

in directory

Bananas for You — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Bar D Trading Post

📍 5507 Highway 60

in directory

Bar D Trading Post — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Bar T Bar Farms

in directory

Bar T Bar Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Barber Orchard Fruitstands Inc.

📍 2855 Old Balsam Road, Waynesville, NC, 28786

in directory

Barber Orchard Fruitstands Inc. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Barber's Farm

📍 3617 State Route 30, Middleburgh, NY, 12122

in directory

Barber's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Barden Family Orchard

📍 56 Elmdale Road, North Scituate, RI, 02857

in directory

A 95-year family-owned U-pick orchard at 56 Elmdale Road in North Scituate, RI — Providence County, Rhode Island. Founded 1931. Open daily 9 am – 6 pm mid-August through Thanksgiving. U-pick apples (17 varieties across September–October), peaches, raspberries, pumpkins; also blueberries, sweet corn, and other expansion crops. Picking season runs late summer through November with late-storage apples wrapping up the year.

orchardapplespeachesraspberries

Bardo Farm

📍 92 Forehand Road, Croydon, 03773

in directory

Bardo Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Barefoot Farmstead

📍 Cornelia, GA, 30531

in directory

Barefoot Farmstead — a Certified Naturally Grown produce and flowers operation in Cornelia, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Barker's Farm

📍 216 Portsmouth Avenue, Stratham, NH, 03885

in directory

A working family farm with seasonal farm-stand retail at 216 Portsmouth Avenue in Stratham, NH — Seacoast New Hampshire, Rockington County. Harvest-cycle operation: closed in winter, opens mid-May. Produce + cut flowers from the farm's own fields. The farm-stand retail format keeps the food dollar inside the operation.

farm-standcut-flowersfamily-farmseasonal

Barkham Creek Farms

📍 168 Haslett Road

in directory

Barkham Creek Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Barrett's Produce of Youngsville

📍 8 Tarboro Road, Youngsville, NC, 27596

in directory

Barrett's Produce of Youngsville — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bartlett's Orchard Farm Market

📍 575 Swamp Road

in directory

Bartlett's Orchard Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Bass Farms

📍 840 Bass Lane, Mount Vernon, IA, 52314

in directory

Bass Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bass Root Farm LLC

📍 Fenton, MI, 48430

in directory

Bass Root Farm LLC — a Certified Naturally Grown produce and flowers operation in Fenton, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Bates Nut Farm

📍 15954 Woods Valley Road, Valley Center, CA, 92082

in directory

Bates Nut Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Baugher's Fruits & Vegetables

in directory

Baugher's Fruits & Vegetables — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Baugher's Orchard & Farm

600 ac

📍 1015 Baugher Road, Westminster, MD, 21158

in directory

A 600-acre Baugher-family century-farm orchard in Westminster, Maryland — founded as a 60-acre parcel in 1904, grew through the 1930s when the family began baking pies from the orchard's fruit, and in 1948 opened the still-running Restaurant & Fruit Market on West Main Street to retail the orchard's production directly. Now one of the largest orchards in Maryland, four-generation family-operated, with on-orchard U-pick, a bakery, an in-town restaurant and fruit market, and an ice-cream program.

orchardcentury-farmfamily-farmu-pick

Baxter's Orchard

📍 5482 East Parkway, Cosby, TN, 37722

in directory

Baxter's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Bay Area Makerfarm

in directory

Bay Area Makerfarm is a community-operated venue in Alameda, CA combining urban agriculture (goats, chickens, ducks, 50+ edible plant varieties) with a free-compost hub, bike-repair workshops, tool libraries, and arts programs. Outreach is anchored to residents of the adjacent Alameda Point Collaborative housing community.

urban-farmcommunity-venuemakerspacemutual-aid

Bay view farm

in directory

Bay view farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bayfield Apple Co.

in directory

Bayfield Apple Co. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Beans and Greens Farmstand

📍 245 Intervale Road, Gilford, 03249

in directory

Beans and Greens Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bear Fruit Farms

📍 30595 Wyatt Drive, Harrisburg, OR, 97446

in directory

A small family-owned U-pick blueberry farm near Harrisburg, Oregon — open mid-June through mid-August. Practices a transparent-without-certification approach: uses organic fertilizers and pest-control materials with two declared exceptions (a light commercial fertilizer in early spring, herbicide treatments twice yearly for weed management). Expanding propane-burner weed control to reduce herbicide use over time. Hand-picked exclusively; the operator argues 'no machine can ever be as discriminating as the human hand and eye.' Also produces blueberry butter for online sales.

berry-farmblueberriesu-picktransparent-non-certified

Bear Grains Tiny Store

📍 3068 East Oak Grove Road, Byron, IL, 61010

in directory

Bear Grains Tiny Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedgrain-farm

Beardsley's Cider Mill and Orchard

📍 278 Leavenworth Road, Shelton, CT, 06484

in directory

Beardsley's Cider Mill and Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Beauchene Berry Farm

📍 9020 Bluegrass Road, Knoxville

in directory

Beauchene Berry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Beaverland Farms

📍 Detroit, MI, 48223

in directory

Beaverland Farms — a Certified Naturally Grown produce and flowers operation in Detroit, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Bechdolt's Orchards

in directory

Bechdolt's Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Beckners' Farm Fresh Produce

📍 6318 Booker T. Washington Highway

in directory

Beckners' Farm Fresh Produce — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bedner's Farm Market

📍 1520 Bower Hill Road, Upper St. Clair, PA, 15241

in directory

A two-location working farm and retail market — production farm in Mercer, PA (western Pennsylvania farm country) plus a satellite farm market at 1520 Bower Hill Road in Upper St. Clair (Pittsburgh's south hills suburbs). The Upper St. Clair location retails produce grown on the Mercer farm directly to the metro audience. Open daily 10 am – 5 pm during the growing season; online ordering with farm-pickup also available.

farm-standtwo-locationmercer-paupper-st-clair

Bee Haven Farm & Apiary

📍 Yorktown, VA, 23692

in directory

Bee Haven Farm & Apiary — a Certified Naturally Grown apiary operation in Yorktown, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Bee's Wing Farm

📍 White Post, VA, 22663

in directory

Bee's Wing Farm — a Certified Naturally Grown produce and flowers operation in White Post, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Beechwood Farms

📍 204 Bates Bridge Road, Marietta, 29661

in directory

Beechwood Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bell Urban Farm

📍 Conway, AR, 72032

in directory

Bell Urban Farm — a Certified Naturally Grown produce and flowers operation in Conway, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Belltown Hill Orchards

📍 483 Matson Hill Road, Glastonbury, CT, 06073

in directory

Belltown Hill Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Ben's Sugar Shack

📍 83 Webster Highway, Temple, NH, 03084

in directory

A New England maple operation in Temple, New Hampshire, producing 100% pure maple syrup and value-adding the syrup into candy, cream, sugar, flavored syrups, sauces, and a separate honey line. The operator's path into sugaring began at age 5 on a preschool field trip to a sugar house — the kind of generational continuity the sugaring economy quietly depends on.

maple-sugarbushvalue-addnew-englanddirect-from-farm

Benjamin Vineyards

📍 6516 Whitney Road

in directory

Benjamin Vineyards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvineyard

Bennett's Honey Farm

📍 3176 Honey Lane, 93015

in directory

Bennett's Honey Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Bernie's Berries

📍 5421 Groometown Road, Greensboro, NC, 27407

in directory

A multi-generational strawberry farm just south of Greensboro, North Carolina — operating for nearly 60 years on the same family land. Sells pre-picked berries at an on-farm welcome counter and offers pick-your-own from the fields when the season is open. Recently adapted into a drive-through model to keep direct-from-farm sales running through pandemic disruptions.

berry-farmstrawberryu-pickmulti-generational

Bernier Farms and Storage

📍 316 New Dam Road, Sanford, ME, 04073

in directory

Bernier Farms and Storage — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Berry Hill Farm

📍 4855 Linne Road, CA

in directory

Berry Hill Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Berry Patch Farms

📍 786 Arnold Mill Road

in directory

Berry Patch Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Bertie County Peanuts (Powell & Stokes, Inc.)

📍 217 US-13, Windsor, NC, 27983

in directory

Bertie County Peanuts (Powell & Stokes, Inc.) — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Beth’s Farm Market

📍 1986 Western Road, Warren, ME, 04864

in directory

Beth’s Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bey Family Farms

📍 Demorest, GA, 30535

in directory

Bey Family Farms — a Certified Naturally Grown produce and flowers operation in Demorest, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

BHAGWAANGARH JAIVIK UTPADAK SAMITI BHAGWANGARH

📍 Rajasthan, India

in directory

BHAGWAANGARH JAIVIK UTPADAK SAMITI BHAGWANGARH — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

BHAPINI ORGANIC GROWER GROUP SOCIETY RAJASTHAN

📍 Rajasthan, India

in directory

BHAPINI ORGANIC GROWER GROUP SOCIETY RAJASTHAN — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Bhoomi India Agtech Pvt Ltd

📍 Karnataka, India

in directory

Bhoomi India Agtech Pvt Ltd — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Bialecki Farms

📍 Thompson, Pennsylvania (Susquehanna County)

in directory

A vegetable farm in Thompson, Pennsylvania (Susquehanna County, on the Pocono bioregion's western edge), producing fresh vegetables for direct-sale and farmers'-market distribution. One of the few directory-listed operations from the western edge of the bioregion's Wayne-County-dominated AgroLegacy network — Susquehanna County extension that connects through the regional aggregator markets.

vegetablesfamily-farmpennsylvaniapoconos

Big Dipper Farm LLC

📍 Zeeland, MI, 49464

in directory

Big Dipper Farm LLC — a Certified Naturally Grown produce and flowers operation in Zeeland, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

BILESHWAR JAIVIK UTPADAN KRISHAK SAMITI SORDA

📍 Rajasthan, India

in directory

BILESHWAR JAIVIK UTPADAN KRISHAK SAMITI SORDA — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Billy Smith's Watermelons Inc.

📍 237 Northeast 11th Avenue, Trenton, FL, 32693

in directory

Billy Smith's Watermelons Inc. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bing Cherries

in directory

Bing Cherries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Biorich Agro Private Limited

📍 Kerala, India

in directory

Biorich Agro Private Limited — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

BIOWIN AGRO RESEARCH

📍 Kerala, India

in directory

BIOWIN AGRO RESEARCH — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Birch's Product Market

📍 9141 Stephen Decatur Hwy, Berlin, MD, 21811

in directory

Birch's Product Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Bird Fork Farm

📍 Dunlap, TN, 37327

in directory

Bird Fork Farm — a Certified Naturally Grown produce and flowers operation in Dunlap, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Birdie & The Bees Farm

📍 Ellettsville, IN, 47429

in directory

Birdie & The Bees Farm — a Certified Naturally Grown produce and flowers operation in Ellettsville, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Biwater Farm

in directory

Biwater Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Black Cat Lavender Farm

📍 1040 Indiana Avenue, Cañon City, CO, 81212

in directory

Black Cat Lavender Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

Black Dog Bees & Maple Trees, LLC

📍 Lebanon, NH, 03766

in directory

Black Dog Bees & Maple Trees, LLC — a Certified Naturally Grown produce and flowers operation in Lebanon, NH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

BLACK PARTRIDGE FARMS

📍 Uttar Pradesh, India

in directory

BLACK PARTRIDGE FARMS — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

Black Trumpet Farm

📍 Leicester, NC, 28748

in directory

Black Trumpet Farm — a Certified Naturally Grown mushrooms operation in Leicester, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Blackberry Creek Mini Farm

📍 173 Blackberry Ln, Augusta, GA, 30906

in directory

Blackberry Creek Mini Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Blackberry Food Co-op

📍 926 East Main Street, Cottage Grove, OR, 97424

in directory

Blackberry Food Co-op — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Blackbranch Farm

📍 Julian, PA, 16844

in directory

Blackbranch Farm — a Certified Naturally Grown produce and flowers operation in Julian, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Blackburn Gardens

📍 314 West Blackburn Road, Mount Vernon, 98273

in directory

Blackburn Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Blake's Cider Mill

in directory

Blake's Cider Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Blanchard Farms

📍 255 West Greenville Road, Scituate, RI, 02857

in directory

Blanchard Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Blanchard Mountain Farm

20 ac

📍 Bow, WA (Chuckanut Drive area, Samish Flats)

in directory

A 20-acre certified-organic farm in Bow, WA — Samish Flats, near Edison on Chuckanut Drive. Founded 2013. Retired from commercial annual-crop production at the end of the 2023 season; now growing a smaller program of perennial herbs, rhubarb, flowers, and native Pacific Northwest plants for wholesale, while hosting other wholesale farmers on the 20 acres and renting out a guest house. Ecological-stewardship commitment with hundreds of native PNW plants restored on the property. Farm stand permanently closed; no CSA or direct-to-consumer retail.

certified-organicretired-commercialperennial-herbsnative-plants

Blandford Nature Center Farm

📍 Grand Rapids, MI, 49504

in directory

Blandford Nature Center Farm — a Certified Naturally Grown produce and flowers operation in Grand Rapids, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Blandford Nature Center Farm

📍 Grand Rapids, MI, 49534

in directory

Blandford Nature Center Farm — a Certified Naturally Grown produce and flowers operation in Grand Rapids, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Blase Family Farm

📍 1232 East Fork Drive, Rockwall, TX, 75087

in directory

Blase Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

BLK ProjeK — Libertad Urban Farm

📍 972 Simpson Street, Bronx, NY (Hunts Point)

in directory

Libertad Urban Farm is a 4,500-sq-ft women-led urban farm in Hunts Point, South Bronx, run by The BLK ProjeK (now Black Feminist Project), the food-justice org founded in 2006 by Tanya Fields. Mission: economic development and food sovereignty for women of color through urban agriculture.

urban-farmBIPOC-ledwomen-ledBlack-led

Blok Orchard

📍 6365 4 Mile Road Northeast, Ada, MI, 49301

in directory

Blok Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Bloomers

in directory

Bloomers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Blooming Acres Farms

📍 Bloomingdale, MI, 49026

in directory

Blooming Acres Farms — a Certified Naturally Grown livestock operation in Bloomingdale, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Blooming Hill Farm

📍 1251 NY 208, Monroe, NY, 10950

in directory

Blooming Hill Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Blooms & Berries Farm Market

in directory

Blooms & Berries Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Blooms on Belmont

📍 Waymart, Pennsylvania (Wayne County)

in directory

A small Waymart, Pennsylvania (Wayne County) farm producing cut flowers — sunflowers and dahlias as the signature lines — alongside small-scale goat and beef operations. The flower-and-livestock combination is unusual at this scale; together they create a year-round revenue rhythm with summer flowers and year-round meat.

cut-flowerssunflowersdahliasgoat

Blue Bench Farms

📍 33772 Highway 257, Windsor, CO, 80550

in directory

Blue Bench Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Blue Hills Orchard

in directory

Blue Hills Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Blue Hollow Farm

📍 Waymart, Pennsylvania (Wayne County)

in directory

A small farm in Waymart, Pennsylvania (Wayne County), producing a distinctive combination of pasture-raised duck meat and eggs alongside log-grown gourmet mushrooms. The duck-and-mushroom pairing is unusual in regional small-farm economics — both are niche products with strong direct-to-consumer markets but limited wholesale demand. The combination suggests deliberate diversification toward products that the bioregion's restaurants and direct customers value but that larger-scale producers don't supply.

duckmushroomlog-grownniche

Blue Moon Acres Farm Store

in directory

Blue Moon Acres is a Certified Organic farm in Buckingham, PA, and Pennington, NJ, pioneering regenerative 'dry-land' rice production and high-nutrient microgreens.

direct-from-farmosm-verifiedvegetable-farmorganic

Blue River Feed Supply

in directory

Blue River Feed Supply — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Blue Stone Farm

📍 Otsego, MI, 49078-9606

in directory

Blue Stone Farm — a Certified Naturally Grown produce and flowers operation in Otsego, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Blueberry Bay Farm

in directory

Blueberry Bay Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Blueberry Glenn

in directory

Blueberry Glenn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Blueberry Hill by the Appalachian Trail

in directory

Blueberry Hill by the Appalachian Trail — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Blueberry Hill Store

📍 2944 White Hill Road, Cameron, NC, 28326

in directory

Blueberry Hill Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Blueberryheel Farms

📍 13972 US-701, Ingold, NC, 28441

in directory

Blueberryheel Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Bmore Legacy Farm

📍 Baltimore, MD, 21217

in directory

Bmore Legacy Farm — a Certified Naturally Grown produce and flowers operation in Baltimore, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

BMS ORGANIC FARMER PRODUCER COMPANY LIMITED

📍 Uttar Pradesh, India

in directory

BMS ORGANIC FARMER PRODUCER COMPANY LIMITED — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

Bobcat Central Inc

📍 1890 East Gerard Avenue, Merced, 95341

in directory

Bobcat Central Inc — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Bobwhite Acres

📍 3879 East Mill Hill Road, Coopersburg, PA, 18036

Bobwhite Acres is a PYO farm in Coopersburg, PA; stays depublished after 2026-05-11 editorial review for lack of substantive alignment (generic local-only focus).

direct-from-farmosm-verifiedorchard

Boldly Grown Farm

📍 Bow, WA (Skagit Valley)

in directory

Boldly Grown Farm is a 60-acre certified-organic vegetable farm in Skagit Valley, Washington, running year-round production for a self-serve farm stand in Bow, CSAs across Seattle / Bellingham / Skagit, and Pacific Northwest wholesale.

certified-organiccsafarm-standwholesale

Boley Farm

📍 60462

in directory

Boley Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bolton Spring Farm

in directory

Bolton Spring Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bombay Masala Company Pvt. Ltd

📍 Maharashtra, India

in directory

Bombay Masala Company Pvt. Ltd — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Bomgaars

in directory

Bomgaars — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Boone Ranch Beef

📍 894 Farm-to-Market Road 49, 75773

in directory

Boone Ranch Beef — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Boothby's Orchard

in directory

Boothby's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Botanical Bites & Provisions

📍 Spotsylvania County, VA

in directory

A 10-acre veteran-owned family farm in Spotsylvania County, Virginia, growing vegetables, fruits, and herbs without pesticides or herbicides, plus honey and beeswax-based natural cosmetics. Certified Virginia Grown and Clean Green Grower; accepts SNAP.

herb-farmveteran-ownedfamily-farmno-pesticides

Bow Hill Blue Berries

in directory

Bow Hill Blue Berries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Bowman's Orchard Farmer's Wagon

in directory

Bowman's Orchard Farmer's Wagon — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Boyd Farm Market

in directory

Boyd Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Boyer Orchards

in directory

Boyer Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Boyes Springs Fruit Basket

in directory

Boyes Springs Fruit Basket — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Brad's Farm Market

📍 550 Asbury Road, Churchville, MD, 21028

in directory

Brad's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Braddock Farms (Grow Pittsburgh)

📍 1000 Braddock Avenue, Braddock, PA, 15104

in directory

An urban farm + on-site farm-stand operated by Grow Pittsburgh (nonprofit, since 2005) at 1000 Braddock Avenue in Braddock, PA — Allegheny County, the historically-significant steel-mill town just east of Pittsburgh. Grows fresh produce for the Braddock community and the broader Pittsburgh metro. Farm stand: Wednesdays + Fridays 3:30–6 pm (June–October) and Saturdays 9 am–1 pm (April–Thanksgiving). Hosts the annual Braddock Zucchini Festival (July) and Fall Festival (Sept/Oct). Site of Grow Pittsburgh's Urban Farmers in Training (UFIT) program — paid farm-work apprenticeship for ages 14–18.

urban-farmfarm-standcsa-pickupnonprofit-operated

Bradley's Market

in directory

Bradley's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Bramble and Butterfly Farm

📍 State Road, NC, 28676

in directory

Bramble and Butterfly Farm — a Certified Naturally Grown produce and flowers operation in State Road, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Branch Hill Farm

📍 Milton Mills, NH, 03852

in directory

Branch Hill Farm — a Certified Naturally Grown produce and flowers operation in Milton Mills, NH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Bre- El honey farm

📍 LaPorte, IN, 46350

in directory

Bre- El honey farm — a Certified Naturally Grown apiary operation in LaPorte, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Bread and Butter Farms LLC

📍 Sparta, GA, 31087

in directory

Bread and Butter Farms LLC — a Certified Naturally Grown produce and flowers operation in Sparta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Brenckle's Farm Market

in directory

Brenckle's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Bridge Avenue Berries

📍 Allenwood, PA, 17810

in directory

Bridge Avenue Berries — a Certified Naturally Grown produce and flowers operation in Allenwood, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Broadfork Farm

📍 Moseley, VA, 23120

in directory

Broadfork Farm — a Certified Naturally Grown produce and flowers operation in Moseley, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Broadview Farm and Gardens

📍 Marengo, IL, 60152

in directory

Broadview Farm and Gardens — a Certified Naturally Grown produce and flowers operation in Marengo, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Broken Spoke Farm

📍 5601 Saint Marys Road, Hillsborough, NC, 27278

in directory

Broken Spoke Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Brookvale Mercantile

in directory

Brookvale Mercantile — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Brossman's Farm

in directory

Brossman's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Brown & Brown Farms

in directory

Brown & Brown Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Brown's Ranch

5,000 ac

📍 Bismarck, North Dakota, USA

in directory

A 5,000-acre North Dakota ranch that became the canonical case study for regenerative cropland transformation — soil organic matter tripled from 1.9% to 6.1%, water infiltration up 16×, synthetic fertilizers eliminated by 2010. The reference point for "can it scale?"

regenerativeno-tillsoil-healthnorth-dakota

BroxonBerry

📍 Markle, IN, 46770-9703

in directory

BroxonBerry — a Certified Naturally Grown produce and flowers operation in Markle, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Brummel Farms

📍 13349a Faxon Road, Plano, IL, 60545

in directory

Brummel Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Brushy Mountain Farm & Orchard

📍 7673 NC-16, Moravian Falls, NC, 28654

in directory

Brushy Mountain Farm & Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Bryant Farms Produce

📍 34 Hemlock Drive, Bakersville, NC, 28705

in directory

A 30+ year working farm at 34 Hemlock Drive in Bakersville, NC — Mitchell County, southern Appalachians. Specializes in heirloom tomatoes and grows squash, zucchini, green peppers, cucumbers, strawberries, lettuce, onions, cabbage, and seasonal vegetables. Listed in the Appalachian Sustainable Agriculture Project's local-food guide. Supplies regional stores with farm-fresh produce.

heirloom-tomatoesvegetablefamily-farmasap-appalachian-grown

Buchan's Blueberry Hill

📍 1472 Nelson Road, Traverse City, MI, 49686

in directory

Buchan's Blueberry Hill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Buckridge Orchard

📍 29832 640th Street, Milville, MN

in directory

Buckridge Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Bucktown Seed

📍 Pottstown, PA, 19465

in directory

Bucktown Seed — a Certified Naturally Grown produce and flowers operation in Pottstown, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Buffalo Creek Berry Farm

📍 Lexington, GA, 30648

in directory

Buffalo Creek Berry Farm — a Certified Naturally Grown produce and flowers operation in Lexington, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Buffalo Creek Farm and Creamery, LLC

📍 3255 Buffalo Creek Farm Road, Germanton, NC, 27019

in directory

Buffalo Creek Farm and Creamery, LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Bugle Boy Farm

📍 Summerfield, NC, 27358

in directory

Bugle Boy Farm — a Certified Naturally Grown produce and flowers operation in Summerfield, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Bumble Bee Acres

📍 Blackstone, VA, 23824

in directory

Bumble Bee Acres — a Certified Naturally Grown produce and flowers operation in Blackstone, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Bunshnong Organic Producers Cooperative Society Ltd. (ICS- I)

📍 Meghalaya, India

in directory

Bunshnong Organic Producers Cooperative Society Ltd. (ICS- I) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Bunshnong Organic Producers Cooperative Society Ltd. (ICS- II)

📍 Meghalaya, India

in directory

Bunshnong Organic Producers Cooperative Society Ltd. (ICS- II) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Buppert's / Doran's Chance Farm

📍 6914 Ridge Road, Marriottsville, MD, 21104

in directory

CSA-anchored diversified vegetable farm in Marriottsville, Maryland (Chesapeake Tidewater bioregion), operating an April–November growing season. The CSA share program is the farm's primary retail surface — directly linking household subscribers to the farm's seasonal harvest.

vegetable-farmcsadirect-from-farmmarriottsville

Burch Farms Country Market

📍 9210 Sidehill Road, North East, PA, 16428

in directory

Burch Farms is a 7th-generation family farm (est. 1779) in North East, PA, serving as a regional hub for Integrated Pest Management (IPM) and sustainable fruit production.

direct-from-farmosm-verifiedipmlegacy

Burek Farms

📍 381 E 400 S, La Porte, IN, 46350

in directory

Burek Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Burger's Market

in directory

Burger's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Buried Farm Vineyard and Orchard

📍 10365 80th Street Northeast, Otsego, MN, 55362

in directory

Buried Farm Vineyard and Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvineyard

Burkholder's Farm Market

📍 1577 Continental Boulevard, Danville, PA, 17821

in directory

Burkholder's Farm Market is a local produce market in Washingtonville, PA; stays depublished after 2026-05-11 editorial review for lack of substantive alignment (generic local-only focus).

vegetable-farmfarm-marketfood-accessfmnp

Burnhams Maple Farm & Market

📍 1124 U.S. Route 7 South, Middlebury, VT, 05753

in directory

Burnhams Maple Farm & Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Burning River Farm

📍 Frederic, WI, 54837

in directory

Burning River Farm — a Certified Naturally Grown produce and flowers operation in Frederic, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Burns Farm

in directory

Burns Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Burr Oak Acres

in directory

Burr Oak Acres — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Burrell's Navarino Orchard

📍 3655 Cherry Valley Turnpike, Navarino, NY, 13215

in directory

Burrell's Navarino Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Burton Brooks Peach Orchards

in directory

Burton Brooks Peach Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Burton Farms

in directory

Burton Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Bushel & Peck

in directory

Bushel & Peck — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Bushels and Bags Farm

📍 Ridgeway, SC, 29130

in directory

Bushels and Bags Farm — a Certified Naturally Grown produce and flowers operation in Ridgeway, SC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Butte Mountain Farm

📍 Jackson, CA, 95642

in directory

Butte Mountain Farm — a Certified Naturally Grown produce and flowers operation in Jackson, CA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Butternut Farm

📍 195 Meaderboro Road, Farmington, NH, 03835

in directory

Butternut Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Button Brook Farm

📍 Bridgetown, NS, B0S1C0

in directory

Button Brook Farm — a Certified Naturally Grown produce and flowers operation in Bridgetown, NS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

C R Fisher Farm

📍 17747 East Highway 120

C R Fisher Farm is an orchard in Ripon, CA; stays depublished after 2026-05-11 editorial review for lack of substantive alignment (generic local-only focus).

direct-from-farmosm-verifiedorchard

C&C Micro Farm

in directory

C&C Micro Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Cabin Brook Farm

📍 Honesdale, Pennsylvania (Wayne County)

in directory

A small farm in Honesdale, Pennsylvania (Wayne County), producing hay and custom-cut beef. Operates at the scale where hay is both a marketable product and a working forage for the on-farm beef operation — the integrated hay-and-livestock model that's the bedrock of small Pocono-region cattle farming.

haycustom-beeflivestockpennsylvania

Cackleberry Farm & Garden

📍 9548 Hopi Road, WY, 82601

in directory

Cackleberry Farm & Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Camden Tomato House

📍 939A East King Avenue, Kingsland, GA, 31548

in directory

Camden Tomato House — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

CamFlor

📍 2364 Riverside Road, Watsonville, CA, 95076

in directory

CamFlor — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Cape Abilities Farm

📍 Cape Cod, MA

in directory

20-year-old organic farm on Cape Cod operated by Cape Abilities, a nonprofit serving people with disabilities. The farm is a dual social-enterprise + therapeutic program — producing organic produce, flowers, and plants while providing meaningful work and skill-building opportunities for individuals with disabilities across the Cape Cod community.

vegetable-farmflower-farmorganicsocial-enterprise

Capital Bees

📍 Ottawa, ON, K1B 4Z3

in directory

Capital Bees — a Certified Naturally Grown apiary operation in Ottawa, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

CAPPACALE FOODS PRIVATE LIMITED

📍 Kerala, India

in directory

CAPPACALE FOODS PRIVATE LIMITED — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Caradonna Farms

📍 1394 United States Highway 9W, Marlboro, NY, 12542

in directory

Caradonna Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Carlsbad Strawberry Company

in directory

Carlsbad Strawberry Company — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Carol's

📍 102 Holly Street, Ellisville, MS, 39437

in directory

Carol's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Carol's Blueberry Patch

📍 15 Laurel Ridge Road, Lowell, OH

in directory

Carol's Blueberry Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Carolina Blueberry

📍 11421 US-701, Garland, NC, 28441

in directory

Carolina Blueberry — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Carpenter Creek

in directory

Carpenter Creek — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Carpinito Brothers U-Pick Pumpkin Patch (Seasonal)

in directory

Carpinito Brothers U-Pick Pumpkin Patch (Seasonal) — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Carr's Ciderhouse

📍 295 River Drive

in directory

Carr's Ciderhouse — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Carson Ridge Evergreens Christmas Tree Farm

📍 3041 Carson Road, Placeville, CA

in directory

Carson Ridge Evergreens Christmas Tree Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

Carter Hill Orchard

📍 73 Carter Hill Road, Concord, NH, 03303

in directory

A diversified orchard at 73 Carter Hill Road in Concord, New Hampshire, growing apples, peaches, plums, and blueberries, plus a pumpkin patch and farm-grown vegetables. Operates an on-farm cider operation, a maple sugar shack, and a bakery that's locally known for cider donuts. Sells through pick-your-own, an on-farm country store, and bakery counter.

orcharddiversifiedu-pickon-farm-bakery

Cash and Carry Barn

📍 1003 Lafayette Road, Clarksville, TN, 37042

in directory

Cash and Carry Barn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Cassabaum Farm

📍 31950 US 98, Elberta, AL, 36530

in directory

Cassabaum Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Castle Rock Orchard

in directory

Castle Rock Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Catapano Farms

📍 47420 Main Road, Southold, NY, 11971

in directory

Catapano Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Catbird Corner Flower Stand

📍 304 Goffstown Back Road, Goffstown, NH, 03045

in directory

Catbird Corner Flower Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Cathy's Corner

in directory

Cathy's Corner — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Catskill Natural Farm

📍 Shandaken, NY, 12480

in directory

Catskill Natural Farm — a Certified Naturally Grown produce and flowers operation in Shandaken, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Cavanna Farms

📍 80 Woodland Street, Glastonbury, CT, 06073

in directory

Cavanna Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

CBI Giving Tree Farm

in directory

CBI Giving Tree Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

Cedar Grove Farm

📍 Stephens, GA, 30667

in directory

Cedar Grove Farm — a Certified Naturally Grown produce and flowers operation in Stephens, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Cedardale Orchards

in directory

Cedardale Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Centennial 6 Farms

📍 22702 Monke Road, Mount Olive, IL, 62069

in directory

Centennial 6 Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Center Grove Orchard

📍 32835 610th Avenue, Cambridge, IA, 50046

in directory

A year-round orchard and agritourism operation in Cambridge, Iowa, with a strawberry U-pick in spring, a 400,000-tulip cut-flower display across four acres, baby-animal seasons in spring, apples and pumpkins in fall, and holiday celebrations in winter. The pattern is a four-season working farm that runs as a destination as well as a producer.

orchardagritourismu-pickcut-flower

Cervenka Farm Store

in directory

Cervenka Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Chacko Farms

📍 9384 Brookville Road, Plymouth, 48170

in directory

Chacko Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

CHAITANYA MUTUALLY AIDED CO-OPERATIVE SOCIETY LIMITED

in directory

CHAITANYA MUTUALLY AIDED CO-OPERATIVE SOCIETY LIMITED — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

CHAKRAVARTHY ORGANIC EXPORT

📍 Tamil Nadu, India

in directory

CHAKRAVARTHY ORGANIC EXPORT — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Chamberlin's Garden & Farm Market

📍 100 River Road, Underhill, VT, 05489

in directory

Chamberlin's Garden & Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Charles Harris Farm

📍 18600 North Ripon Road, Ripon, CA, 95366

in directory

Harris Orchards (Natural Orchards) is a multi-generational family farm in Ripon, CA, providing 'naturally grown' cherries and stone fruit through a direct-to-consumer U-Pick model.

direct-from-farmosm-verifiedorchardnaturally-grown

Chas W. Bangerter & Son Local Farm and Stand

📍 1304 Orchard Drive East, Bountiful, UT, 84010

in directory

Chas W. Bangerter & Son Local Farm and Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Chase Farms Market

in directory

Chase Farms Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Chase Hill Farm

📍 74 Chase Hill Rd, Warwick, MA

in directory

An organic, 100% grass-fed dairy and diversified livestock farm on Chase Hill Road in Warwick, Massachusetts — operating a creamery alongside the dairy. The 'diversified livestock' framing means meat animals are part of the operation in rotation with the dairy herd, not as a side enterprise.

dairylivestock-farmgrass-fedcertified-organic

Chateauvert Farm

📍 Mountain Grove, MO, 65711

in directory

Chateauvert Farm — a Certified Naturally Grown produce and flowers operation in Mountain Grove, MO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Chatham Berry Farm

📍 2309 Route 203, Valatie, NY, 12184

in directory

Chatham Berry Farm — a family-owned berry farm and farm store in Valatie, NY, growing no-spray, pesticide-free greens and vegetables in their greenhouses year-round, alongside summer pick-your-own fruit. Farm-store retail of natural, organic, and local produce.

berry-farmfamily-ownedpesticide-freeno-spray

Chehalis Valley Farms

📍 69 Taylors Ferry Road, 98541

in directory

Chehalis Valley Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Chelan Ranch Organics

in directory

Chelan Ranch Organics — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Cherokee Strip Mercantile

📍 6916 306th Drive, Arkansas City, KS, 67005-5591

in directory

Cherokee Strip Mercantile — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Cherry Orchards

📍 10340 OH-669, Crooksville, OH, 43731

in directory

Cherry Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Cherry Point Farm Market

in directory

Cherry Point Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Cherry U-Pick at Third Coast Fruit Co.

📍 555 Wilson Road, Traverse City, MI, 49686

in directory

Cherry U-Pick at Third Coast Fruit Co. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Chesh

📍 402 Geyser Road, Saratoga Springs, NY, 12866

in directory

Chesh — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Chester Agricultural Center

📍 10 Greycourt Avenue, Chester, NY, 10918

in directory

Chester Agricultural Center — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Chhapadia Organics Private Limited

📍 Odisha, India

in directory

Chhapadia Organics Private Limited — an NPOP-certified organic operator in Odisha, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiaodisha

Chicago Farm Flowers Inc.

📍 Chicago, IL, 60612

in directory

Chicago Farm Flowers Inc. — a Certified Naturally Grown produce and flowers operation in Chicago, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Chicago Honey Co-op

📍 Chicago, IL, 60609

in directory

Chicago Honey Co-op — a Certified Naturally Grown apiary operation in Chicago, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Chip-In-Farm

📍 201 Hartwell Road

in directory

Chip-In-Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Christmas Tree Shed

📍 17 Herrick Road, Boxford, MA, 01833

in directory

Boxford, MA choose-and-cut tree farm established 1965 on land with seven generations of Herrick family history. The 100-acre property was donated to the New England Forestry Foundation in 1990 to be held as a community forest; tree operation continues alongside maintained public trails.

christmas-tree-farmcommunity-forestconservation-easementsince-1965

Chue's Farm

📍 57-146 Kamehameha Highway, Kahuku, HI, 96731-2156

in directory

Chue's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Cider House

in directory

Cider House — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Circle Brook Farm

80 ac

📍 141 Brighton Road, Andover, NJ, 07821

in directory

An 80-acre certified-organic diversified vegetable farm in Andover Township, NJ (Sussex County) — Poconos foothills. Practices regenerative methods; specializes in heirloom variety selection. Serves roughly 700 CSA members across 12 CSA groups in northern and central New Jersey (delivering as far south as Monmouth and Ocean counties), plus six farmers markets (Denville, Fair Lawn, Hoboken, Jersey City, Montclair). Donated over 41,000 lbs of produce to LocalShare in 2022.

certified-organicregenerative-agricultureheirloomdiversified-vegetable

Circle R Fruit Farms

📍 Roosevelt Highway

in directory

Circle R Fruit Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Clare Farms

📍 2341 Lewis Avenue, Ida, MI, 48140

in directory

Clare Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Clark Family Mushrooms

📍 Orfordville, WI, 53576

in directory

Clark Family Mushrooms — a Certified Naturally Grown mushrooms operation in Orfordville, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Clark Farm Market

📍 201 Bedford Road, Carlisle

in directory

Clark Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Clark Farms

📍 382 Main Street, Damariscotta, ME, 04543

in directory

Clark Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Classic City Gourmet Mushrooms

📍 Athens, GA, 30606

in directory

Classic City Gourmet Mushrooms — a Certified Naturally Grown mushrooms operation in Athens, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Clatskanie Food Hub

📍 Art Steele

in directory

Clatskanie Food Hub — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Clay Fish Farm

📍 Bear Creek, NC, 27207

in directory

Clay Fish Farm — a Certified Naturally Grown produce and flowers operation in Bear Creek, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Clay Hill Corners

📍 390 Clay Hill Road, Hartland, VT, 05048

in directory

Clay Hill Corners — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Clayton Farms

📍 24290 Shore Highway, Denton, MD, 21629

in directory

Clayton Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Clear Bottom Lake Farm

📍 Comstock Park, MI, 49321

in directory

Clear Bottom Lake Farm — a Certified Naturally Grown produce and flowers operation in Comstock Park, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Clear Water Farms

📍 Fayetteville, AR, 72704

in directory

Clear Water Farms — a Certified Naturally Grown produce and flowers operation in Fayetteville, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Clendenen's Cider Works

📍 96 12th Street, Fortuna, CA, 95540

in directory

Clendenen's Cider Works — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Clinton Farm Market

in directory

Clinton Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Cloud Eleven Mountain Farm LLC

📍 Moyie Springs, ID, 83845

in directory

Cloud Eleven Mountain Farm LLC — a Certified Naturally Grown produce and flowers operation in Moyie Springs, ID. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Clover Nook Farm

in directory

Clover Nook Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Clucas Farms West

in directory

Clucas Farms West — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Coastal Foodshed - Curbside Pickup Point

📍 W Rodney French Boulevard, New Bedford, MA, 02744

in directory

Coastal Foodshed - Curbside Pickup Point — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Cobble Knoll Orchard

📍 1672 East Road, Benson, VT, 05743

in directory

Cobble Knoll Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Cobblestone Farm

in directory

Cobblestone Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Cobblestone Farm LLC

📍 HOTCHKISS, CO, 81419-6701

in directory

Cobblestone Farm LLC — a Certified Naturally Grown produce and flowers operation in HOTCHKISS, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Codman Community Farms

📍 58 Codman Road, Lincoln, MA, 01773

in directory

A 53-year community farm in Lincoln, MA — founded 1973 — operating with a stated regenerative-farming and community-education mission. Diversified livestock (laying hens, broiler chickens, turkeys, pigs, beef cattle), flower and market gardens, community gardens, on-site farm store and kitchen, educational programs, and a Thursday meals program. Tagline: 'Creating community through food & farming since 1973.'

community-farmregenerative-agriculturediversified-livestocksince-1973

Coinjock Creek Farms / Griggs Snowden House

📍 112 Maple Road, Maple, NC, 27956

in directory

Coinjock Creek Farms / Griggs Snowden House — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Cold Spring Orchard

📍 391 Sabin Street

in directory

University of Massachusetts research orchard in Belchertown growing more than 100 apple varieties — 18 in market quantity, including Baldwin, Golden Russet, Roxbury Russet, Claville Blanc, and Honeycrisp. Operates under Integrated Pest Management; farmstand revenue funds tree-fruit research and extension.

orchardipmresearch-orcharduniversity-affiliated

Collard King, Inc.

📍 Seffner, FL, 33584

in directory

Collard King, Inc. — a Certified Naturally Grown produce and flowers operation in Seffner, FL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Colorado Aromatics Farm

📍 Longmont, CO, 80504

in directory

Colorado Aromatics Farm — a Certified Naturally Grown produce and flowers operation in Longmont, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Columbia Farms U Pickup

📍 21024 Northwest Gillihan Road, Portland, OR, 97231

in directory

Columbia Farms U Pickup — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Comb’s Wholesale Produce Company

📍 2131 US 601, Mocksville, NC, 27028

in directory

Comb’s Wholesale Produce Company — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Common Ground Alaska

4 ac

📍 6189 S. Carat, Big Lake, AK

in directory

A 4-acre teaching farmstead in Big Lake, Alaska — Mat-Su Valley. Mission: 'To build a community of Alaskans that can achieve food freedom through sustainable, simple, and traditional living.' Operates an orchard (apples, currants, honeyberries, saskatoons, cherries) and a large greenhouse for cold-climate production; runs U-pick by appointment, a plant nursery, educational classes and workshops, a winter blacksmithing program (The Forge), and publishes Sustainable Alaska Magazine. Hosts the annual Alaska Homestead Expo and runs the Alaska Homestead Academy.

teaching-farmsteadfood-freedomfood-sovereigntyalaska-homesteading

Common Ground Organic Farm

📍 Spring Mills, Pennsylvania (Centre County, Penns Valley)

in directory

A Green Seal certified working farm and native-plant operation in Spring Mills, Pennsylvania (Centre County, Penns Valley), combining organic vegetable production with native-plant propagation.

nurserynative-plantsorganicgreen-seal

Common Hands Farm

📍 Hillsdale, NY, 12529

in directory

Common Hands Farm — a Certified Naturally Grown produce and flowers operation in Hillsdale, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Community Farm at Roundabout Meadows

📍 Aldie, VA, 20105

in directory

Community Farm at Roundabout Meadows — a Certified Naturally Grown produce and flowers operation in Aldie, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Comstock Family Farm

in directory

Comstock Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Concord Produce & Fish Market

in directory

Concord Produce & Fish Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Conebella Farm

in directory

Conebella Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Confreda Farms

in directory

Confreda Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Connie's Country Market

in directory

Connie's Country Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Connors Farm

📍 30 Valley Road

in directory

Connors Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

CONTIL INDIA LIMITED

📍 Gujarat, India

in directory

CONTIL INDIA LIMITED — an NPOP-certified organic operator in Gujarat, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiagujarat

Conuco Farm, LLC

📍 New Paltz, NY, 12561

in directory

Conuco Farm, LLC — a Certified Naturally Grown produce and flowers operation in New Paltz, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Conway Produce

📍 Leavenworth, KS, 66048

in directory

Conway Produce — a Certified Naturally Grown produce and flowers operation in Leavenworth, KS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Cook Farm

📍 1 East Hadley Road

in directory

Cook Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Cook's Orchard Store

in directory

Cook's Orchard Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Cooks Valley Farm Store

in directory

Cooks Valley Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Cooper Farm Market

📍 484 Cemetery Road, Falls Creek, PA, 15840

in directory

Cooper Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Copia Farm

📍 8352 Johnstown-Alexandria Road, 43031

in directory

Copia Farm — a family-owned regenerative, pasture-raised livestock operation in Johnstown, Ohio. Beef, pork, chicken, lamb, bison, eggs, grass-fed raw milk, and seasonal produce — all GMO-free, with earth-regenerating practices central to the farm's stated mission.

regenerativepasture-raisedgrass-fedraw-milk

Corelife Wholefoods Private Limited

📍 Maharashtra, India

in directory

Corelife Wholefoods Private Limited — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Corey Lake Orchards

📍 12147 Corey Lake Rd, Three Rivers, MI 49093

in directory

150-acre family orchard, vineyard, and field operation in Three Rivers, Michigan, founded in 1961 and still run by the founding family. Heritage apples are pressed into hard cider on-site; integrated bakery, winery, cidery, and distillery close the loop between orchard and finished product.

orchardheritage-applesmulti-generationalcidery

Cornell's Farm Stand

📍 1934 Tamarac Road, Johnsonville, NY, 12094

in directory

A family farm and seasonal farm stand at 1934 Tamarac Road in Johnsonville, NY — Rensselaer County, eastern Hudson Valley uplands. Multi-season rhythm: spring (nursery, flowers, pick-your-own strawberries), summer (sweet corn, vegetables, eggs, garlic), fall (pumpkin picking, hayrides, corn mazes, cider donuts). Also sells cut flowers, greenhouse plants, maple syrup, hay.

farm-standu-pickstrawberriessweet-corn

Cosmos Farm

📍 Carrollton, GA, 30117

in directory

Cosmos Farm — a Certified Naturally Grown produce and flowers operation in Carrollton, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Cottage Oven

📍 22 South Beach Street, Ormond Beach, FL, 32174

in directory

Cottage Oven — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Cottontown Farm

📍 Cottontown, TN, 37048

in directory

Cottontown Farm — a Certified Naturally Grown produce and flowers operation in Cottontown, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Country Corner Farm Market

in directory

Country Corner Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Country Farm Market

📍 1235 Dolsontown Road, Middletown, NY, 10940

in directory

Country Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Country Fresh West

in directory

Country Fresh West — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Country Gardens Farm

📍 Newnan, GA, 30265

in directory

Country Gardens Farm — a Certified Naturally Grown produce and flowers operation in Newnan, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Country Lane Market

📍 4515 Tampico Road, Tampico, IL, 61283

in directory

Country Lane Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Country Mill

📍 4648 Otto Road, Charlotte, MI, 48813

in directory

Country Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvineyard

Country Mill Farms, Bakery, Orchard & Cider Mill

📍 4648 Otto Road, Charlotte, MI, 48813-9723

in directory

Country Mill — a family-owned 213-acre organic orchard, bakery, cidery, and winery in Charlotte, Michigan. Grows organic blueberries, peaches, and apples; produces fresh-pressed cider, applesauce, apple butter, apple chips, and apple-cider vinegar from its own fruit. Pick-your-own operations across apples, blueberries, peaches, sunflowers, and pumpkins.

orchardorganicfamily-ownedpick-your-own

Country Tyme Fruitstand

📍 7760 US 49, Hattiesburg, MS, 39402

in directory

Country Tyme Fruitstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Countryside Produce and Nursery

📍 629 East King Street, King, NC, 27021

in directory

Countryside Produce and Nursery — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

County Line Orchard

📍 9200 Kings Highway, Kempton, PA, 19529

in directory

A 43-year family-run orchard in Kempton, PA — Berks County, Pennsylvania Dutch country, at the foot of the Kittatinny Ridge. Founded 1982 by the Flukes family. Specializes in apples (12+ named varieties: Gala, Honeycrisp, Jonathan, Fuji, Crimson Crisp, Melrose, Golden Delicious, Ida Red, Suncrisp, Rome, Keepsake, Goldrush), plus peaches, blueberries, and other stone fruit. Operates a farm market alongside seasonal pick-your-own.

orchardapplespeachesblueberries

Couture's Maple Shop

📍 560 Vt Route 100

in directory

Couture's Maple Shop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Couturier Blueberry Farm

📍 2687 North Jebavy Drive, 49431

in directory

Couturier Blueberry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Cozy Nook Farm

📍 S11 W30780 Summit Ave., Waukesha, WI 53188

in directory

Sixth-generation family dairy in Waukesha, Wisconsin, milking ~65 registered Brown Swiss and Guernsey cows. Diversifies through 40+ pumpkin varieties, gourds, Indian corn, and a Christmas tree program with educational farm tours.

dairychristmas-tree-farmmulti-generationalheritage-breed

Crated Earth Farm

📍 Willis, MI, 48191

in directory

Crated Earth Farm — a Certified Naturally Grown produce and flowers operation in Willis, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Creek Side Market Garden

📍 Maple Park, IL, 60151

in directory

Creek Side Market Garden — a Certified Naturally Grown produce and flowers operation in Maple Park, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Cresset Farms

📍 5609 East County Road 52, Fort Collins, CO, 80524

in directory

Cresset Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Crest Haven Farm Market

📍 307 Columbia Boulevard, Bloomsburg, PA, 17815

in directory

Crest Haven Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Crestwood Family Farms

📍 13118 IL Route 176, Woodstock, IL, 60098

in directory

Crestwood Family Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Crickhollow Farm

📍 Palmyra, VA, 22963

in directory

Crickhollow Farm — a Certified Naturally Grown produce and flowers operation in Palmyra, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Crooked Porch Farm

📍 Hillsville, VA, 24343

in directory

Crooked Porch Farm — a Certified Naturally Grown produce and flowers operation in Hillsville, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Crooked Row Farm and Market

📍 3245 PA 309, Orefield, PA, 18069

in directory

Crooked Row Farm and Market — a certified-organic, woman-owned vegetable farm in Orefield, PA founded by Liz Wagner. Seasonal vegetables, fresh herbs, pasture-raised eggs, and shelf-stable farm products; the farm store stocks Crooked Row alongside other local producers, and the operation runs youth job training in partnership with community organizations.

vegetable-farmcertified-organicwoman-ownedpasture-raised

Crop Culture Farm

📍 Newborn, GA, 30056

in directory

Crop Culture Farm — a Certified Naturally Grown produce and flowers operation in Newborn, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Crossing Brook Farmstand

in directory

Crossing Brook Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Crossroads Farm and Garden

📍 Alma, GA, 31510

in directory

Crossroads Farm and Garden — a Certified Naturally Grown produce and flowers operation in Alma, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Crossroads Farm at Grossman's

📍 Hempstead Avenue

in directory

Crossroads Farm at Grossman's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Crowfoot Farm (u-pick)

in directory

Crowfoot Farm (u-pick) — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Crowley Garden Farm

📍 broomfield, CO, 80021

in directory

Crowley Garden Farm — a Certified Naturally Grown produce and flowers operation in broomfield, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Crown Heights Farmstand

📍 Crown Street, Brooklyn, NY, 11225

in directory

Crown Heights Farmstand — a producer-only food access program in NYC operated by [[grownyc]], the environmental nonprofit that runs the city's Greenmarkets, youth farms, and Fresh Food Box network. Listed because the operator's curation is the verification: every GrowNYC market and farmstand is producer-only, prioritizes Black, Indigenous, and farmer-of-color vendors, and is sited where mainstream grocery has underserved.

direct-from-farmosm-verifiedvegetable-farm

Cucurbit Farm

📍 20 Parker Street, Acton, MA, 01720

in directory

Cucurbit Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Cullipher Farm Berry and Pumpkin Patch

📍 772 Princess Anne Road, Virginia Beach, VA, 23457

in directory

Cullipher Farm Berry and Pumpkin Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Cullipher Farm Market

📍 1444 Princess Anne Road, Virginia Beach, VA, 23456

in directory

Cullipher Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Culp Fruits

in directory

Culp Fruits — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Cultivate Farms

📍 Bend, OR, 97702

in directory

Cultivate Farms — a Certified Naturally Grown produce and flowers operation in Bend, OR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Cumbria Gardens

in directory

Cumbria Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

D&S Homestead

📍 10887 Stookesberry Road, Lisbon, OH, 44432-9612

in directory

D&S Homestead — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Da Berry Fresh Market

📍 520 South Hopkins Street, New Iberia, LA, 70560

in directory

Da Berry Fresh Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Daddy Pete's Plant Pleaser

📍 1210 Smith Farm Rd, Stony Point, NC, 28678

in directory

Daddy Pete's Plant Pleaser — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Daisy Creek vineyard

in directory

Daisy Creek vineyard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvineyard

Daisyfish Farm

📍 Danielsville, GA, 30633

in directory

Daisyfish Farm — a Certified Naturally Grown produce and flowers operation in Danielsville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Dakin Farm

📍 5797 Route 7, Ferrisburgh, VT, 05456

in directory

Dakin Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Damouni Farms

📍 2391 Reid Road, Flint, MI, 48507

in directory

Damouni Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Dan's Feed & Seed

in directory

Dan's Feed & Seed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Dances With Bees

📍 Cornelia, GA, 30531

in directory

Dances With Bees — a Certified Naturally Grown apiary operation in Cornelia, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Dancing Dog Farm

📍 Hotchkiss, CO, 81419

in directory

Dancing Dog Farm — a Certified Naturally Grown produce and flowers operation in Hotchkiss, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Dancing Spring Garden

📍 Donaldson, AR, 71941

in directory

Dancing Spring Garden — a Certified Naturally Grown produce and flowers operation in Donaldson, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Darathia Farm Store

in directory

Darathia Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Dark Water Ranch

📍 1169 CR E1465, Ninnekah, OK, 73067

in directory

Dark Water Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Davenport Farms

📍 3411 Route 209, Stone Ridge, NY, 12484

in directory

Davenport Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Daves Tackle Shop

in directory

Daves Tackle Shop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Davis & Son Orchards

📍 922 NC-18, Lawndale, NC, 28090

in directory

Davis & Son Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Davis Farm Fresh Produce

📍 13475 Wards Road, Lynchburg, VA, 24501

in directory

Davis Farm Fresh Produce — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Davis Girls Peach Shed

in directory

Davis Girls Peach Shed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Davy's Fresh Market

📍 444 Airport Rd

in directory

Davy's Fresh Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Daydream Farm

📍 Everson, WA, 98247

in directory

Daydream Farm — a Certified Naturally Grown produce and flowers operation in Everson, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Deans Farm Market

📍 4231 NC-42 Highway East, Wilson, NC, 27893

in directory

Deans Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

DECCAN GRAINZ PRIVATE LIMITED

in directory

DECCAN GRAINZ PRIVATE LIMITED — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Decker Farm

📍 435 Richmond Hill Road, Staten Island, NY (Historic Richmond Town site)

in directory

The oldest continuously-farmed land in New York City — under cultivation since 1810, operated today by Historic Richmond Town as a working historic farm. Pick-your-own crops, harvest festivals, school programs, and the institutional anchor for what farming has looked like on Staten Island for two centuries. NYC's last surviving working farmstead from the borough's agricultural era.

historicstaten-islandnycworking-museum

Deep Hallow Ranch

in directory

Deep Hallow Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Deep Roots Farm

📍 Moscow, ID, 83843

in directory

Deep Roots Farm — a Certified Naturally Grown produce and flowers operation in Moscow, ID. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Deep Roots Farm

📍 57685 Main Road, Southold, NY, 11971

in directory

Deep Roots Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Deer Creek Farm

📍 Covington, GA, 30014

in directory

Deer Creek Farm — a Certified Naturally Grown produce and flowers operation in Covington, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Deer Run Farms Orchard

📍 2695 Route 11A, La Fayette, NY, 13084

in directory

Deer Run Farms Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Deer View Farms

📍 Beach Lake, Pennsylvania (Wayne County)

in directory

A family farm in Beach Lake, Pennsylvania (Wayne County), producing free-range chicken eggs, beef from a Hereford cattle herd, and hay. Hereford is a specifically-chosen heritage breed — known for hardiness and grass-finishing capability — and its presence here signals deliberate breed selection rather than commodity-cattle defaults.

eggsherefordbeefhay

Deercrest Farm Market

📍 3499 Hebron Avenue, Glastonbury, CT, 06033

in directory

Deercrest Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Deerfield Christmas Tree Farm

📍 14 Pulaski Road, Whitehouse Station, NJ, 08889

in directory

Deerfield Christmas Tree Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

DeFeo's Farm & Garden

📍 6456 Weymouth Road, Mays Landing, NJ, 08330

in directory

DeFeo's Farm & Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

DeForest Farmers’ Market

📍 120 South Stevenson Street, DeForest, WI, 53532

in directory

DeForest Farmers’ Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Degroot's Strawberries

📍 4232 Bull Run Road, Gregory, MI, 48137

in directory

Degroot's Strawberries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Deitsch Farm Market

in directory

Deitsch Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Del-Cur Supply Co-Op

in directory

Del-Cur Supply Co-Op — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Del's Farm Market

in directory

Del's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Delaney Farms

📍 Kasson Road

in directory

Delaney Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Delaney's Wood Fired Maple Syrup

📍 1050 South Grand Jean Road, Rose City, MI, 48654

in directory

A family-operated Northern Michigan sugarbush in Rose City, established 1996, producing pure Michigan maple syrup using wood-fired evaporation rather than reverse osmosis. The name itself is the editorial filter: wood-fired is the traditional sugaring method, slower and more labor-intensive than RO, and increasingly rare as commercial sugarhouses convert. Sells direct through e-commerce.

maple-sugarbushwood-firedtraditional-methodmulti-generational

Delta farm

in directory

Delta farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

DELTASPHARMA INDIA PRIVATE LIMITED

📍 Uttarakhand, India

in directory

DELTASPHARMA INDIA PRIVATE LIMITED — an NPOP-certified organic operator in Uttarakhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttarakhand

Dema Dadenggre Organic Producers Cooperative Society Ltd

📍 Meghalaya, India

in directory

Dema Dadenggre Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Demicco's Honey

📍 Landenberg, PA, 19350

in directory

Demicco's Honey — a Certified Naturally Grown apiary operation in Landenberg, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Derby Ridge Farm

in directory

Derby Ridge Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Derby Ridge Farm Mini-Stand

in directory

Derby Ridge Farm Mini-Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Deshields Farm

in directory

Deshields Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Detering Orchards

📍 30946 Wyatt Drive, Harrisburg, OR, 97446

in directory

Detering Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Devriendt Farm

📍 178 South Mast Street, Goffstown, NH, 03045

in directory

A family farm in Goffstown, NH — Hillsborough County, New Hampshire uplands — operating two locations (178 S. Mast St. + 47 Story Rd.). Runs a farm stand, nursery/greenhouse, ice cream stand, and seasonal pick-your-own (strawberries in summer, pumpkins with corn maze in fall) plus Christmas trees and wreaths in winter. Grows its own nursery stock and provides gardening expertise + plant-identification assistance at the stand.

family-farmnurserygreenhouseu-pick

Dey Farm

in directory

Dey Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Dhansiripar Organic Grower Association

📍 Nagaland, India

in directory

Dhansiripar Organic Grower Association — an NPOP-certified organic operator in Nagaland, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindianagaland

Diamond Hill Farm

📍 Athens, GA, 30605

in directory

Diamond Hill Farm — a Certified Naturally Grown produce and flowers operation in Athens, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Dickerson Family Market

📍 32867 Sussex Highway, Laurel, DE

in directory

Dickerson Family Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Dickey Farms

in directory

Dickey Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Dickeys Farm Store

in directory

Dickeys Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Diederich Produce LLC

📍 3537 East Grand River Avenue

in directory

Diederich Produce LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Diengpasoh Organic Producers Cooperative Society Ltd

📍 Meghalaya, India

in directory

Diengpasoh Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Digging in the Dirt, a Schoolyard Garden

📍 Surf City, NJ, 08008

in directory

Digging in the Dirt, a Schoolyard Garden — a Certified Naturally Grown produce and flowers operation in Surf City, NJ. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

DiTomaso Farms

📍 37137 US 50 Bus, Pueblo, CO, 81006

in directory

DiTomaso Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Dittmar Family Farms

📍 Between Felton and Harrington, Kent County, DE

in directory

A family farm between Felton and Harrington practicing regenerative agriculture, working toward Certified Naturally Grown status. Operates a CSA with shares ranging from $24/week (small) to $51/week (large) for a 16-week season; share content includes vegetables, fruit, eggs, meat birds, and fresh-cut flower bouquets. Most produce is farm-grown; supplemental produce comes from other Delaware farms practicing similar regenerative methods.

regenerativecsaharringtonkent-county

DJ's Berry Patch

📍 1223 Salem Church Road, Apex, NC, 27523

in directory

DJ's Berry Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Dodd's Farm Supply

📍 1103 Lynchburg Avenue, Brookneal, VA, 24528

in directory

Dodd's Farm Supply — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Dodo Farms

📍 Mount Airy, MD, 21771

in directory

Dodo Farms — a Certified Naturally Grown produce and flowers operation in Mount Airy, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Dog Rose Farm

📍 16 Harvey Mill Road, Lee, NH, 03861

in directory

Dog Rose Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Dondero Orchards

📍 Woodland Street, Glastonbury, CT

in directory

Dondero Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Donnie's Market

📍 8138 Seashore Highway, Bridgeville, DE, 19933

in directory

Donnie's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Donovan Orchards

in directory

Donovan Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Door County Wildwood Market

📍 2208 Wildwood Road, Door County, WI, 54234

in directory

Five-generation family cherry orchard and pumpkin/produce farm in Door County, Wisconsin — designated century farm (same family stewardship since 1846; cherry operations since 1915). Hand-harvests cherries despite available mechanization, preserving traditional methods. Operates pick-your-own cherry, pumpkin, and decorative-gourd seasons plus a weekly Jacksonport farmers market presence.

orchardcherry-orchardpumpkin-patchdoor-county

Double C Bar Ranch & Blueberries

in directory

Double C Bar Ranch & Blueberries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Doud Orchards

📍 8971 North State Road 19, Denver

in directory

Doud Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Douglas Orchard & Farm

📍 36 Locust Street, Douglas, MA, 01516

in directory

Douglas Orchard & Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Douglas Strawberry Patch

in directory

Douglas Strawberry Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Dover vineyards

in directory

Dover vineyards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvineyard

Doylestown Farms

📍 4566 Durham Road, Doylestown, PA, 18902

in directory

Doylestown Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Dragon Flame Farm & Wellness

📍 Ocklawaha, FL, 32179

in directory

Dragon Flame Farm & Wellness — a Certified Naturally Grown livestock operation in Ocklawaha, FL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Draper Girls Country Farm

in directory

Draper Girls Country Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Driftless Prairie Meats and Market

📍 Loganville, WI, 53943

in directory

Driftless Prairie Meats and Market — a Certified Naturally Grown livestock operation in Loganville, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Drunken goats farm

in directory

Drunken goats farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedgrain-farm

Dryer's

in directory

Dryer's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

DSM Ramganga Organic Farm

📍 Uttar Pradesh, India

in directory

DSM Ramganga Organic Farm — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

DSR Import export

📍 Maharashtra, India

in directory

DSR Import export — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

DSR Import export

📍 Maharashtra, India

in directory

DSR Import export — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Duda's Farm Market

in directory

Duda's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Duncan’s Farm

in directory

Duncan’s Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

DUNES ORGANIC FARMERS SOCIETY JATAWAS

📍 Rajasthan, India

in directory

DUNES ORGANIC FARMERS SOCIETY JATAWAS — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Dunn's Farm Market

📍 4 South Tamaqua Drive, Tamaqua, PA, 18252

in directory

Dunn's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Duris Cucumber Farm

📍 6012 44th Street East, Puyallup, WA, 98371

in directory

Duris Cucumber Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Dutch Country Farm Market

📍 3190 Schuylkill Road

in directory

Dutch Country Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Duurzame Growers

📍 Ariss, ON, N0B 1B0

in directory

Duurzame Growers — a Certified Naturally Grown produce and flowers operation in Ariss, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Duvall Farms

in directory

Duvall Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Dykeman Farms

in directory

Dykeman Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Early Bird Eats

📍 7561 North 49th Street, Longmont, CO, 80503-8846

in directory

Early Bird Eats — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Early Bird Farm

📍 Tacoma, WA, 98443

in directory

Early Bird Farm — a Certified Naturally Grown produce and flowers operation in Tacoma, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Earth & Dirt Family Farm and Revival Garden Service LLC

📍 Liberty, NC, 27298

in directory

Earth & Dirt Family Farm and Revival Garden Service LLC — a Certified Naturally Grown produce and flowers operation in Liberty, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Earth & Skye Farm

📍 Orland Park, IL, 60462

in directory

Earth & Skye Farm — a Certified Naturally Grown produce and flowers operation in Orland Park, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Earth Expo Company

📍 Gujarat, India

in directory

Earth Expo Company — an NPOP-certified organic operator in Gujarat, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiagujarat

Earth Family Organics

📍 1109 Agricultural Street, Raleigh, NC, 27603

in directory

Earth Family Organics — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Earth Sky Time Community Farm

📍 1547 Main Street, Manchester Center, VT, 05255

in directory

A three-generation certified-organic farmstead in Manchester, Vermont — 6 acres of organic vegetables, 1½ acres of pick-your-own berries and flowers, high-tunnel greenhouses, a wood-fired bakery, an on-site sawmill, and a concert venue. Expanded in 2018 by acquiring 200 acres south of the original site on Route 7A. Sells through farmers markets across the region (Manchester, Dorset, Londonderry, Ludlow, Cambridge NY, Williamstown MA), plus on-farm retail of breads, spreads, pastries, and bulk staples. Hosts Sunday evening summer concerts at the on-farm barn-stage.

certified-organicvegetableberriesflowers

Earth's Keepers

📍 5100 Kingsessing Avenue, Philadelphia, 19143

in directory

Earth's Keepers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

EARTHLIFE ESSENTIALS PRIVATE LIMITED

📍 Uttar Pradesh, India

in directory

EARTHLIFE ESSENTIALS PRIVATE LIMITED — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

Earthmother Farm

📍 Annan, ON, N0H1B0

in directory

Earthmother Farm — a Certified Naturally Grown produce and flowers operation in Annan, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Earths Promise Farm

📍 4306 Mount Eden Road, Shelbyville, KY, 40065

in directory

Earths Promise Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Earthvox Farm

📍 37272 Marcola Road, Springfield, OR, 97478-8763

in directory

Earthvox Farm is a 50-acre organically-managed goat dairy in Springfield, OR (Willamette Valley) running purebred Nubians on silvopasture with rotational grazing. Raw milk, yogurts, and cheeses move to households via herdshare with delivery across Springfield, Eugene, and Creswell.

dairygoat-dairyraw-milkherdshare

Easterling's Big Peach

in directory

Easterling's Big Peach — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Eastward Gardens

📍 Hardinsburg, IN, 47125

in directory

Eastward Gardens — a Certified Naturally Grown produce and flowers operation in Hardinsburg, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Echoes Farmstead

📍 Gainesville, GA, 30506

in directory

Echoes Farmstead — a Certified Naturally Grown produce and flowers operation in Gainesville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

ECO City Farms

📍 Edmonston, MD, 20781

in directory

ECO City Farms — a Certified Naturally Grown produce and flowers operation in Edmonston, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Ecobay Farms

📍 Brooklyn, New York City

in directory

An urban microgreens farm and produce operation in Brooklyn, NY — 'Grown with love in NYC' — delivering microgreens and fresh produce to Brooklyn, Queens, Manhattan, the Bronx, and Westchester County. Wednesday and Friday delivery schedule plus Sunday pickups. Small-scale urban agriculture serving the New York City metro fresh-food landscape.

urban-farmmicrogreensurban-agriculturebrooklyn

ECOLITE NATURAL FARMING SOCIETY BHOJPUR

📍 Rajasthan, India

in directory

ECOLITE NATURAL FARMING SOCIETY BHOJPUR — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Ecovillage of Loudoun

📍 Lovettsville, VA, 20180

in directory

Ecovillage of Loudoun — a Certified Naturally Grown produce and flowers operation in Lovettsville, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Ed's Farm Fresh Fruits & Vegetables

in directory

Ed's Farm Fresh Fruits & Vegetables — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Eddy Farm

📍 851 Willard Avenue, Newington, CT, 06111

in directory

Eddy Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Eden East Farm Market

📍 1910 Main Street, Bastrop, TX, 78602

in directory

Eden East Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Eden Pure Beef

📍 Stephens, GA, 30667

in directory

Eden Pure Beef — a Certified Naturally Grown livestock operation in Stephens, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Edgewater Farm

📍 246 NH Route 12A, Plainfield, NH, 03781

in directory

A family-owned working farm on the Connecticut River in Plainfield, NH — Sullivan County, central Connecticut River Valley. Operates a flagship farmstand and a commercial kitchen that specializes in 'making the most out of excess crops' — zucchini converted into noodles, surplus tomatoes into fresh salsa, glut-into-shelf-stable products that would otherwise be field-loss. Farmstand restocked daily from the fields. Strawberry season opens the year in June; closes mid-October.

family-farmvalue-added-from-excesson-site-commercial-kitchenstrawberries

Edgewood Apiaries

📍 3456 James Madison Highway, Bremo Bluff, VA, 23022

in directory

A Fluvanna County, Virginia apiary producing honey and beeswax, and value-adding the beeswax into a small line of handcrafted candles, soaps, balms, and body-care products made on the farm with raw oils, butters, and essential oils. Sells direct at the farm, online, and at regional farmers markets.

apiarydirect-from-farmvalue-addbody-care

Eggs

in directory

Eggs — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Eggs for BTC Lightning

in directory

Eggs for BTC Lightning — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Eichelberg Farms

in directory

Eichelberg Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Eighth Day Farm

📍 Holland, MI, 49424

in directory

Eighth Day Farm — a Certified Naturally Grown produce and flowers operation in Holland, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Eldorose Farm

📍 Forest City, Pennsylvania (Susquehanna County)

in directory

A diversified farm in Forest City, Pennsylvania (on the Susquehanna County edge of the Pocono bioregion), raising Hereford beef, Berkshire pork, and producing eggs and vegetables. Both livestock breeds are heritage selections — Hereford for hardy grass-finishing, Berkshire for meat quality and pasture compatibility — signaling a farm thinking deliberately about breed-and-system fit rather than defaulting to commodity options.

herefordberkshireheritage-breedeggs

Eldridge Disbrow Farm

in directory

Eldridge Disbrow Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Eldur Heron Farm

📍 Mount Vernon, WA, 98273

in directory

Eldur Heron Farm — a Certified Naturally Grown produce and flowers operation in Mount Vernon, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Elephant Garlic Farm

📍 Milledgeville, GA, 31061

in directory

Elephant Garlic Farm — a Certified Naturally Grown produce and flowers operation in Milledgeville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Eliot Farm

in directory

Eliot Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Elkton Community Education Center

📍 Elkton, OR, 97436

in directory

Elkton Community Education Center — a Certified Naturally Grown produce and flowers operation in Elkton, OR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Ell-Bar Farm

in directory

Ell-Bar Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Ellday Farm

📍 Pleasant Mount, Pennsylvania (Wayne County)

in directory

A multi-generation family dairy farm in Pleasant Mount, Pennsylvania (Wayne County), operated by D. Ellis and Daisy Dix. One of the bioregion's working multi-generation dairy operations — part of the institutional layer that keeps the bioregion's commodity-dairy economics viable through family continuity rather than consolidation.

dairymulti-generationfamily-farmpennsylvania

Ellijay Mushrooms

📍 Ellijay, GA, 30540

in directory

Ellijay Mushrooms — a Certified Naturally Grown mushrooms operation in Ellijay, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Ellis Farms

📍 1206 Confederate Road, Lincolnton, NC, 28092

in directory

Lincoln County, NC family farm running a 75+ year sorghum molasses tradition alongside pasture-raised Berkshire pork, ADGA-registered Nigerian Dwarf dairy goats, and fresh eggs. USDA-inspected processing; sells at Gastonia and Belmont farmers markets. Operates part-time around full-time day jobs.

grain-farmlivestock-farmsorghum-molassespasture-raised

Elm Street Urban Farm

📍 Atlanta, GA, 30314

in directory

Elm Street Urban Farm — a Certified Naturally Grown produce and flowers operation in Atlanta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Elmer Farm

in directory

Elmer Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Elyon's Acres

📍 Churubusco, IN, 46723

in directory

Elyon's Acres — a Certified Naturally Grown produce and flowers operation in Churubusco, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Embudo Valley Organics

in directory

Embudo Valley Organics — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Emerald Street Urban Farm

📍 East Kensington, Philadelphia, PA

in directory

Emerald Street Urban Farm (ESUF) is a Philadelphia urban agriculture project founded around 2005 on vacant lots in East Kensington. Pay-what-you-can produce stands, community garden plots, and partnerships with soup kitchens, restaurants, and galleries blend food work with neighborhood culture.

urban-farmvacant-lotpay-what-you-canfood-access

Emergence Garden

in directory

Emergence Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Emmi's Farm Market

in directory

Emmi's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Encinitas Farms

📍 1911 Saxony Road, Encinitas, CA, 92024

in directory

Encinitas Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Enjoy Pioneer Farm

📍 17N400 Big Timber Road, Hampshire, Illinois, 60140

in directory

Enjoy Pioneer Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Ent Wise Farm

📍 8101 S Timberline Rd, Fort Collins, CO, 80525

in directory

Ent Wise Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Escarpment Gardens

📍 Mono, ON, L9V 1G9

in directory

Escarpment Gardens — a Certified Naturally Grown produce and flowers operation in Mono, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Essex Farm

in directory

Essex Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Eugster's Farm Market

📍 3865 State Highway 138, Stoughton, WI

in directory

A 4th-generation Swiss-immigrant family farm in Stoughton, WI — south-central Wisconsin, near the Four Lakes / Madison region. The Eugster family began farming after migrating from Switzerland in 1926 — the farm is now 99 years deep, approaching century-farm designation. Diversified operation: fresh produce, seasonal events, petting farm, u-cut flowers, farm market retailing the operation's own production.

family-farmswiss-immigrantcentury-farm-approachingsince-1926

Evans Orchard

in directory

Evans Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Even' Star Farm

📍 Lexington Park, MD, 20653

in directory

Even' Star Farm — a Certified Naturally Grown produce and flowers operation in Lexington Park, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Everoak Farm

📍 Orlando, FL, 32807

in directory

Everoak Farm — a Certified Naturally Grown produce and flowers operation in Orlando, FL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Evolutionary Organics

📍 New Paltz, NY, 12561

in directory

Evolutionary Organics — a Certified Naturally Grown produce and flowers operation in New Paltz, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Exist Green

📍 4914 Underwood Avenue, Omaha, NE, 68132-2414

in directory

Exist Green — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

EXOTIC FRUITS PVT LTD

📍 Maharashtra, India

in directory

EXOTIC FRUITS PVT LTD — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

EXOTIC FRUITS PVT LTD

📍 Tamil Nadu, India

in directory

EXOTIC FRUITS PVT LTD — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Fable

in directory

Fable — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Faerie rd farm

in directory

Faerie rd farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

FAIR EXPORTS (INDIA) PVT LTD

📍 Kerala, India

in directory

FAIR EXPORTS (INDIA) PVT LTD — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Fair Weather Acres Farm Market

in directory

Fair Weather Acres Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fairmont Fruit Farm

📍 885 Lincoln Street

in directory

Fairmont Fruit Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Fairport Farms LLC

📍 Kittrell, NC, 27544

in directory

Fairport Farms LLC — a Certified Naturally Grown produce and flowers operation in Kittrell, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Fairview Country Farm

in directory

Fairview Country Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fairview Farms Apiary, LLC

📍 Fairview, MI, 48621

in directory

Fairview Farms Apiary, LLC — a Certified Naturally Grown apiary operation in Fairview, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Faithfully Sown

📍 Troutville, VA, 24175

in directory

Faithfully Sown — a Certified Naturally Grown produce and flowers operation in Troutville, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Faithland Growers

in directory

Faithland Growers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Fall Harvest Apple Orchard

in directory

Fall Harvest Apple Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Fallesen Sheep Ranch

in directory

Fallesen Sheep Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Fambrini's Farm Fresh Produce

in directory

Fambrini's Farm Fresh Produce — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Familia Produce

📍 Tucson, AZ, 85705

in directory

Familia Produce — a Certified Naturally Grown produce and flowers operation in Tucson, AZ. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Family Cow Farmstand

📍 2386 Shelburne Falls Road, Hinesburg, VT, 05461

in directory

Family Cow Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedgrain-farm

Far Away Farms

14 ac

📍 Cherry Ridge Township, Honesdale, Pennsylvania (Wayne County)

in directory

A 14-acre family farm in Cherry Ridge Township, Wayne County, Pennsylvania, owned and operated by Dave and Anita Avvisato. Produces vegetables, herbs, and fruit using natural growing methods and operates an on-farm apiary producing raw honey. Sells direct at the Wayne County Farmers Market in Honesdale. One of the clearest cases of the bioregion's diversified small-acreage farm: under 20 acres, one or two operators, multiple revenue streams (vegetables, herbs, fruit, honey), all sold direct.

family-farmvegetablesherbsraw-honey

Far West Fungi

📍 Farm: Moss Landing, California (Monterey County). Retail: San Francisco Ferry Building, Santa Cruz.

in directory

A family-owned California mushroom farm operating since 1982 — a 20-acre organic facility in Moss Landing (Monterey County) growing specialty and medicinal mushrooms, plus retail stores in San Francisco and Santa Cruz. One of the longest-running specialty-mushroom operations in the US.

mycologyorganicspecialty-mushroomsfamily-farm

Farm & Flower Market

📍 15 Webster Street, Manchester, NH, 03104

in directory

Farm & Flower Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Farm Fresh

📍 3801 Garrett Road, Drexel Hill, PA, 19026

in directory

Farm Fresh — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Farm Fresh Grocers

📍 901 Tyson Avenue, Philadelphia, PA

in directory

Farm Fresh Grocers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Farm Fresh Produce

📍 724 South Pacific Street, Mineola, TX, 75773

in directory

Farm Fresh Produce — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Farm Lot 59

in directory

Farm Lot 59 — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Farm Market

📍 7602 Route 22, Copake, NY, 12516

in directory

Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Farm Shop

📍 249 West Street, West Halfield, MA, 01088

in directory

Farm Shop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmushroom-farm

Farm to Cup & Periwinkle Skies

📍 Milford, NJ, 08848

in directory

Farm to Cup & Periwinkle Skies — a Certified Naturally Grown produce and flowers operation in Milford, NJ. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Farm To You

📍 4615 Menaul Boulevard Northeast, Albuquerque, NM, 87110

in directory

Albuquerque retail outlet aggregating nearly 60 New Mexico farms and small food producers — grass-fed beef and lamb, free-range chicken, pastured eggs, raw honey, kombucha, seasonal produce. Each product is labeled with mileage from source (max 199 miles); no middlemen, no standing orders.

livestock-farmaggregatorlocal-foodmileage-labels

Farmacy

📍 508 South B Street, Easley, SC, 29640

in directory

Farmacy — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Farmer Al's Market & Greenhouses

📍 387 Buckelew Avenue, Monroe Township, NJ, 08831

in directory

A 4th-generation family farm in Monroe Township, NJ — operating continuously since 1924. Grows Jersey-Fresh seasonal produce (Jersey sweet corn, Jersey tomatoes, peppers, eggplant, string beans, broccoli, collards, mustard greens, turnips, kale) and flowering annuals plus vegetable plants. Sells from a historic red barn (an 1860s–1880s farm building) seven days a week, plus a long-running school-and-nonprofit plant-sale fundraising program. Not in the Staten Island bioregion — Monroe Township is central New Jersey, in the inner coastal plain.

century-farmfamily-farmvegetableflowers

Farmer Brown's Market Garden LLC

📍 Groton, NY, 13073

in directory

Farmer Brown's Market Garden LLC — a Certified Naturally Grown produce and flowers operation in Groton, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Farmer Frank’s Produce, LLC

📍 34 Reynoldsons Road, Gates, NC, 27935

in directory

Farmer Frank’s Produce, LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Farmer Jawn

📍 1225 Street Road, West Chester, PA, 19382

in directory

Farmer Jawn is a 128-acre regenerative organic produce farm in West Chester, PA, founded by Christa Barfield and billed as the largest Black-woman-owned regenerative organic farm in the U.S. Chemical-free CSA + storefronts, education programming, and a stated commitment to farm-worker fair wages and healthcare.

vegetable-farmBIPOC-ledBlack-ledwomen-led

Farmer Jenn's

📍 106 Jacobs Place, Aquebogue, NY, 11931

in directory

Farmer Jenn's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Farmer John's Market

in directory

Farmer John's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Farmer John's Produce Inc.

📍 3810 Due W Rd, Marietta, GA 30064

in directory

Farmer John's Produce Inc. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Farmer White's

📍 11373 US-31

in directory

Farmer White's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Farmer’s Daughter

in directory

Farmer’s Daughter — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Farmer’s Market Maui

in directory

Farmer’s Market Maui — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Farmers’ Market Cooperative of East Liberty

📍 344 Sheridan Avenue, Pittsburgh, PA, 15206

in directory

Farmers’ Market Cooperative of East Liberty — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Farmhouse

📍 79-7404 Mamalahoa Highway, Kealakekua, HI, 96750

in directory

Farmhouse — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmushroom-farm

Farming First Organic Grower Group ICS 08

📍 Maharashtra, India

in directory

Farming First Organic Grower Group ICS 08 — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Farms View Roadstand

📍 945 Black Oak Ridge Road, Wayne, NJ, 07470

in directory

Farms View Roadstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Farmstand

in directory

Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Farrahs Farm, LLC

📍 Round Hill, VA, 20141

in directory

Farrahs Farm, LLC — a Certified Naturally Grown produce and flowers operation in Round Hill, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Farside Farms

in directory

Farside Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fat Bear Farm

📍 5 Miller Road, Mount Tremper, 12457

in directory

Fat Bear Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fat Rabbit Farms

📍 Hot Springs, AR, 71901

in directory

Fat Rabbit Farms — a Certified Naturally Grown produce and flowers operation in Hot Springs, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Faye Farm

📍 Danielsville, GA, 30633

in directory

Faye Farm — a Certified Naturally Grown produce and flowers operation in Danielsville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Fazio Farms Pumpkin Patch

in directory

Fazio Farms Pumpkin Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fazlani Exports Private Limited

📍 Maharashtra, India

in directory

Fazlani Exports Private Limited — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Feeders Grain and Farm Supply Inc.

📍 2052 Hunter Trail, Corning, Iowa, 50841

in directory

Feeders Grain and Farm Supply Inc. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fehring Family Farm

in directory

Fehring Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Fellenz Family Farms

📍 Phelps, NY, 14532

in directory

Fellenz Family Farms — a Certified Naturally Grown produce and flowers operation in Phelps, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Fern Valley Market

in directory

Fern Valley Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fertile Valley Farm

📍 Honesdale, Pennsylvania (Wayne County)

in directory

A fully-diversified farm in Honesdale, Pennsylvania (Wayne County), producing beef, pork, eggs, raw milk, and vegetables — one of the most-diversified small operations in the bioregion's directory. The five-stream model is the limit-case of small-farm diversification: every major product category that small farms can profitably produce, all on the same ground, all sold direct.

beefporkeggsraw-milk

Fiddlehead Farm

📍 Rosendale, NY, 12472

in directory

Fiddlehead Farm — a Certified Naturally Grown produce and flowers operation in Rosendale, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Fieldwise

in directory

Fieldwise — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fifer's Farm Market Cafe

📍 200 Cullen Street, Dewey Beach, DE, 19971

in directory

Fifer's Farm Market Cafe — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Finca Yabisi

📍 Corozal, PR (pickup at Old San Juan Saturday market — Calle de Norzagaray, San Juan, PR 00901)

in directory

Finca Yabisi is an agroforestry cacao and fruit farm in Corozal, Puerto Rico, working to revive the island's heirloom cacao heritage via 100% agroecological methods from seed to chocolate. Founded by José D. Crespo de León; product moves via the Old San Juan Saturday market and direct online orders.

cacao-farmagroforestryagroecologyregenerative-organic

Fink's Country Farm

📍 6242 Route 25, Wading River, NY, 11792

in directory

Fink's Country Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Finn Hollow Flowers

in directory

Finn Hollow Flowers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Firdous Community Garden at Mohammed Schools Of Atlanta

📍 Atlanta, GA, 30316

in directory

Firdous Community Garden at Mohammed Schools Of Atlanta — a Certified Naturally Grown produce and flowers operation in Atlanta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Firefly Farm

in directory

Firefly Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Firelight Farm LLC

📍 Searcy, AR, 72143-9219

in directory

Firelight Farm LLC — a Certified Naturally Grown produce and flowers operation in Searcy, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Fishers Orchard

in directory

Fishers Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Fisheye Farms

📍 Detroit, MI, 48208

in directory

Fisheye Farms — a Certified Naturally Grown produce and flowers operation in Detroit, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Fishkill Farms

270 ac

📍 Hopewell Junction, NY (Dutchess County)

in directory

270-acre fourth-generation family farm on the eastern edge of the Hudson Highlands. Heirloom apple orchard (60+ varieties on 70 acres), certified-organic vegetable production, pasture-raised chicken and eggs, pick-your-own seasons that draw tens of thousands of visitors each fall. Founded 1913 by Henry Morgenthau Jr.; today operated by his great-grandson Joshua Morgenthau, who converted the orchard from conventional to Eco Apple/IPM and the vegetable operation to USDA Certified Organic. The farm is a substrate-builder and a public agritourism gateway in one — a working operation that proves regenerative orchards can pencil at scale within an hour of New York City.

orchardorganicagritourismhudson-highlands

Fitch's Corner Farmstand

📍 499 North River Road, Milford, NH, 03055

in directory

Fitch's Corner Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

FitzPatrick Farm Market & Deli

📍 8633 State Route 36, Arkport, NY, 14807

in directory

FitzPatrick Farm Market & Deli — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Five Marys

in directory

Five Marys — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Flea Market

in directory

Flea Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fleet Farm

📍 875, Hastings, 55033

in directory

Fleet Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fleitz Pumpkin Farm

in directory

Fleitz Pumpkin Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fleur-de-lis Farms

📍 Henrico, VA, 23231

in directory

Fleur-de-lis Farms — a Certified Naturally Grown produce and flowers operation in Henrico, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Flint’s Maple

📍 3476 Hermitage Road, Warsaw, NY, 14569

in directory

Flint’s Maple — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Flo-Ray Farm

in directory

Flo-Ray Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Flora Bay Farm

📍 Carbondale, IL, 62903

in directory

Flora Bay Farm — a Certified Naturally Grown produce and flowers operation in Carbondale, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Flower Stand

in directory

Flower Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Fluffy Butt Farms

📍 780 West Kirby Road, Battle Creek, MI, 49017

in directory

Fluffy Butt Farms — a family-owned pasture-raised livestock operation in Battle Creek, Michigan, founded 2020 by Chris and Tawney. Heritage pork (Mangalitsa and Red Wattle), Dexter beef, chicken, goats, and free-range eggs raised without hormones or injections across the farm's woods and orchard.

livestock-farmpasture-raisedheritage-breedhormone-free

Flying Feather Farm

📍 347 Bridgeboro Road, Moorestown Township, NJ, 08057

in directory

Flying Feather Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Flying Pond Farm

📍 184 Town House Road, Vienna, ME, 04360

in directory

Flying Pond Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fo'Castle Farm Country Store

📍 166 Kingsley Road, Burnt Hills, NY, 12027

in directory

Fo'Castle Farm Country Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Fontaine's Peach Outlet

📍 US 45, Quitman, MS, 39355

in directory

Fontaine's Peach Outlet — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Foppema's Farm

📍 1605 Hill Street, Northbridge, MA, 01534

in directory

Foppema's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Forbes Family Farm

📍 Oliver, BC, V0H 1T4

in directory

Forbes Family Farm — a Certified Naturally Grown produce and flowers operation in Oliver, BC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Ford's Farm Supply

📍 1301 South Avenue, Gustine, 95322

in directory

Ford's Farm Supply — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fords Produce Company, Inc.

📍 1109 Agriculture Street, Raleigh, NC, 27695

in directory

Fords Produce Company, Inc. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Foreman farms

📍 6647 schoolhouse Road

in directory

Foreman farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Forge Hill Orchards

📍 135 Blossom Drive, Mount Wolf, 17347

in directory

Forge Hill Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Forino's Corner Farm

📍 208 Breeze Hill Road, New Hampton, NY, 10958

in directory

Forino's Corner Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Forraht Farms

📍 960 East Lemon Creek Road

in directory

Forraht Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Fortunate Farm

in directory

Fortunate Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

FORTUNE AGROMART PRIVATE LIMITED

📍 Uttar Pradesh, India

in directory

FORTUNE AGROMART PRIVATE LIMITED — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

Forty4 Farms

📍 East Gwillimbury, ON, L4B1g6

in directory

Forty4 Farms — a Certified Naturally Grown produce and flowers operation in East Gwillimbury, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Foster Brady Farm

📍 Monroe, GA, 30655

in directory

Foster Brady Farm — a Certified Naturally Grown produce and flowers operation in Monroe, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Fosters Farms

in directory

Fosters Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Four Palms Ranch

📍 Fallbrook, CA, 92028

in directory

Four Palms Ranch — a Certified Naturally Grown produce and flowers operation in Fallbrook, CA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Four Rivers Farm

📍 Wadsworth, IL, 60083

in directory

Four Rivers Farm — a Certified Naturally Grown produce and flowers operation in Wadsworth, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Four Springs Farm

📍 9577 Bachelor Road, Kutztown, PA, 19530

in directory

Four Springs Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Four Star Mushrooms

📍 320 N Oakley Blvd, Chicago, IL, 60612

in directory

An urban controlled-environment mushroom farm operating out of West Town in Chicago — growing specialty mushrooms indoors within the city itself, with both consumer retail and wholesale lines. The operation frames itself explicitly against the monoculture-driven habitat loss of industrial agriculture, positioning urban indoor mushroom cultivation as a decentralized alternative.

mushroom-farmurban-agriculturecontrolled-environmentanti-monoculture

Four Winds Farm

📍 Homestead, IA, 52236

in directory

Four Winds Farm — a Certified Naturally Grown produce and flowers operation in Homestead, IA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Fowler Farms

📍 162 Dreamcatcher Drive, Winchester, 22602

in directory

Fowler Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Fowler Valley Farms

in directory

Fowler Valley Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Fox at the Fork

📍 Monee, IL, 60449

in directory

Fox at the Fork — a Certified Naturally Grown produce and flowers operation in Monee, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Foxwood Farms

📍 Bowman, GA, 30624

in directory

Foxwood Farms — a Certified Naturally Grown produce and flowers operation in Bowman, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Frank's Produce & Greenhouse

📍 6686 Old Waterloo Road, Elkridge, MD, 21075

in directory

Frank's Produce & Greenhouse — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fraser's Garlic Farm

📍 Churchville, NY, 14428

in directory

Fraser's Garlic Farm — a Certified Naturally Grown produce and flowers operation in Churchville, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Freedom Valley Farm

📍 2977 Steubenville Road, Freedom, IN, 47431

in directory

Freedom Valley Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fresh and Flavorful Market

📍 5200 Hanover Road, Hanover, PA, 17331

in directory

Fresh and Flavorful Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fresh for All: Abundant Life Fellowship

📍 4151 Route 130 South, Edgewater Park, NJ, 08010

in directory

Fresh for All: Abundant Life Fellowship — a Fresh for All free fresh-produce distribution site in the Greater Philadelphia region operated by [[philabundance]], the largest hunger-relief organization in the area. Listed because the operator's curation is the verification: Fresh for All is a no-cost, no-questions-asked produce distribution program serving food-insecure neighborhoods, sourced from regional growers and recovered surplus.

direct-from-farmosm-verifiedvegetable-farm

Fresh for All: Camden

📍 400 North 30th Street, Camden, NJ, 08105

in directory

Fresh for All: Camden — a Fresh for All free fresh-produce distribution site in the Greater Philadelphia region operated by [[philabundance]], the largest hunger-relief organization in the area. Listed because the operator's curation is the verification: Fresh for All is a no-cost, no-questions-asked produce distribution program serving food-insecure neighborhoods, sourced from regional growers and recovered surplus.

direct-from-farmosm-verifiedvegetable-farm

Fresh for All: Glassboro

📍 275 Wilmer Street, Glassboro, NJ, 08028

in directory

Fresh for All: Glassboro — a Fresh for All free fresh-produce distribution site in the Greater Philadelphia region operated by [[philabundance]], the largest hunger-relief organization in the area. Listed because the operator's curation is the verification: Fresh for All is a no-cost, no-questions-asked produce distribution program serving food-insecure neighborhoods, sourced from regional growers and recovered surplus.

direct-from-farmosm-verifiedvegetable-farm

Fresh for All: Houseman Recreation Center

📍 Summerdale Avenue & Godfrey Avenue, Philadelphia, PA, 19124

in directory

Fresh for All: Houseman Recreation Center — a Fresh for All free fresh-produce distribution site in the Greater Philadelphia region operated by [[philabundance]], the largest hunger-relief organization in the area. Listed because the operator's curation is the verification: Fresh for All is a no-cost, no-questions-asked produce distribution program serving food-insecure neighborhoods, sourced from regional growers and recovered surplus.

direct-from-farmosm-verifiedvegetable-farm

Fresh for All: Paulsboro

📍 402 Cook Avenue, Paulsboro, NJ, 08066

in directory

Fresh for All: Paulsboro — a Fresh for All free fresh-produce distribution site in the Greater Philadelphia region operated by [[philabundance]], the largest hunger-relief organization in the area. Listed because the operator's curation is the verification: Fresh for All is a no-cost, no-questions-asked produce distribution program serving food-insecure neighborhoods, sourced from regional growers and recovered surplus.

direct-from-farmosm-verifiedvegetable-farm

Fresh for All: Pennsport

📍 Philadelphia, PA, 19147

in directory

Fresh for All: Pennsport — a Fresh for All free fresh-produce distribution site in the Greater Philadelphia region operated by [[philabundance]], the largest hunger-relief organization in the area. Listed because the operator's curation is the verification: Fresh for All is a no-cost, no-questions-asked produce distribution program serving food-insecure neighborhoods, sourced from regional growers and recovered surplus.

direct-from-farmosm-verifiedvegetable-farm

Fresh for All: Souderton

📍 Main Street & Summit Ave, Souderton, PA, 18964

in directory

Fresh for All: Souderton — a Fresh for All free fresh-produce distribution site in the Greater Philadelphia region operated by [[philabundance]], the largest hunger-relief organization in the area. Listed because the operator's curation is the verification: Fresh for All is a no-cost, no-questions-asked produce distribution program serving food-insecure neighborhoods, sourced from regional growers and recovered surplus.

direct-from-farmosm-verifiedvegetable-farm

Fresh for All: Upper Darby

📍 7240 Walnut Street, Upper Darby, PA, 19082

in directory

Fresh for All: Upper Darby — a Fresh for All free fresh-produce distribution site in the Greater Philadelphia region operated by [[philabundance]], the largest hunger-relief organization in the area. Listed because the operator's curation is the verification: Fresh for All is a no-cost, no-questions-asked produce distribution program serving food-insecure neighborhoods, sourced from regional growers and recovered surplus.

direct-from-farmosm-verifiedvegetable-farm

Fresh Fruits and Veggies

📍 Ramseur, NC, 27316

in directory

Fresh Fruits and Veggies — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fresh Future Farm

📍 2008 Success Street, North Charleston, SC, 29405

in directory

BIPOC-led nonprofit urban farm and cooperative grocery store in North Charleston, South Carolina — operating since 2014 on a vacant lot leased from the City of North Charleston. Serves the Chicora-Cherokee neighborhood, a federally-designated food desert. Grows chemical-free produce, runs a SNAP-accepting community grocery store, and offers cooking demonstrations, gardening classes, and farm tours.

urban-farmvegetable-farmBIPOC-ledfood-justice

FRESH MANTRA ORGANICS LLP

📍 Gujarat, India

in directory

FRESH MANTRA ORGANICS LLP — an NPOP-certified organic operator in Gujarat, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiagujarat

Fresh Meadows Farm

📍 194-15 73rd Avenue

in directory

Fresh Meadows Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fresh Vegetables

in directory

Fresh Vegetables — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

FRESH4YOU

in directory

FRESH4YOU — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Freshwater Farms LLC

📍 833 North Lincoln Road, 49829

in directory

Freshwater Farms LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Friske Orchards Farm Market

in directory

Friske Orchards Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Frisky Girl Farm

📍 9905 428th Avenue SE area, North Bend, WA

in directory

A small sustainable-and-organic vegetable-and-flower farm in North Bend, WA — Snoqualmie Valley, on the eastern edge of the Seattle metro. Operates May through November with a customizable CSA program, an on-site farm stand (blue shed at the field entrance), wholesale to local restaurants, and farmers-market vending. The farm's stated principle: 'we believe in growing healthy food to build healthy bodies.' Brings the freshest sustainable produce to North Bend and the Snoqualmie Valley.

vegetable-farmflower-farmsustainableorganic-methods

Frith Farm

📍 61 Ash Swamp Road, Scarborough, ME, 04074

in directory

Frith Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Frog Eagle Farms

📍 46095 Southwest Patton Valley Road, Gaston, OR, 97119

in directory

Frog Eagle Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Froggy Meadow Farm

📍 Beloit, WI, 53511

in directory

Froggy Meadow Farm — a Certified Naturally Grown produce and flowers operation in Beloit, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

From Spore to More

📍 406 South Northwest Highway, Fox River Grove, IL, 60021

in directory

From Spore to More — a family-owned gourmet mushroom farm and retail storefront in Fox River Grove, Illinois, founded April 2022 by Eric and Angel. Grows King Blue Oysters, Elm Z Oysters, Chestnut, and Lion's Mane; supplies restaurants across McHenry County and direct-to-consumers from the Metra-station-adjacent retail location.

mushroom-farmgourmet-mushroomsfamily-ownedfounder-led

Front Porch Farm

in directory

Front Porch Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Frugthaven Farm

in directory

Frugthaven Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Fruit Barn

in directory

Fruit Barn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Fruit City

in directory

Fruit City — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fruitland

📍 106 Eastern Boulevard, Essex, MD, 21221

in directory

Fruitland — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fruits N' Cahoots

in directory

Fruits N' Cahoots — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Fry Farm

📍 Bethlehem, GA, 30620

in directory

Fry Farm — a Certified Naturally Grown produce and flowers operation in Bethlehem, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Fudgetown Farm

📍 Oxford, MS, 38655

in directory

Fudgetown Farm — a Certified Naturally Grown produce and flowers operation in Oxford, MS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Full Earth Farm

📍 Quincy, FL, 32352

in directory

Full Earth Farm — a Certified Naturally Grown produce and flowers operation in Quincy, FL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Full Lotus Farm

📍 Newark, NY, 14513

in directory

Full Lotus Farm — a Certified Naturally Grown produce and flowers operation in Newark, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Full Moon Farm

in directory

Full Moon Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Fuller's Sugar House

in directory

A maple sugarbush operation in Vermont's Northeast Kingdom — OSM-located in NEK Vermont, distinct from the widely-known Fuller's Sugarhouse in Lancaster, NH (which is in the White Mountains, just across the state border but technically NH not VT). Maple syrup production is the primary product. Like every Northeast Kingdom sugarbush, the operation runs the late-winter / early-spring sap-collection rhythm that has shaped the region's foodway for centuries.

maple-sugarbushmaple-syrupnortheast-kingdomvermont

Furrow Farm

📍 25877 Northwest West Union Road, Hillsboro, 97124

in directory

Furrow Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

FYLORADIX BIONATURALS PRIVATE LIMITED

📍 Karnataka, India

in directory

FYLORADIX BIONATURALS PRIVATE LIMITED — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Gade Farm

in directory

Gade Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Gaertners Great Lakes Greens

📍 W2386 County Road A South, Oostburg, WI, 53070-1640

in directory

Gaertners Great Lakes Greens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Gallagher's Farm Market and Bakery

📍 7237 East Traverse Highway, Traverse City, MI, 49684

in directory

Gallagher's Farm Market and Bakery — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Gallop's Sweet Potatoes

in directory

Gallop's Sweet Potatoes — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Garcia Farming Stand

in directory

Garcia Farming Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Garden Stop

in directory

Garden Stop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Garden Treasures

in directory

Garden Treasures — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Garden Window Farm

📍 Denton, NC, 27239

in directory

Garden Window Farm — a Certified Naturally Grown produce and flowers operation in Denton, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Gardening Gays Farm

📍 15267 James Madison Parkway, King George, VA, 22485-3225

in directory

Gardening Gays Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Garlic Delite Farm LLC

📍 Little Falls, NY, 13365

in directory

Garlic Delite Farm LLC — a Certified Naturally Grown produce and flowers operation in Little Falls, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Garner's

in directory

Garner's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Gary's Groceries

in directory

Gary's Groceries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Gathering Together Farm

in directory

Gathering Together Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Gaver Farms

📍 5501 Detrick Road

in directory

Gaver Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Gazer Farm

📍 Hamilton, MI, 49419

in directory

Gazer Farm — a Certified Naturally Grown produce and flowers operation in Hamilton, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Gee Farm

📍 1803 Powder Springs Road SW, Marietta, GA, 30064

in directory

Small produce stand and poultry operation in Marietta, Georgia (Georgia Piedmont) — accepts EBT/SNAP benefits, an uncommon and substantive accessibility commitment for a small farm. Sells fresh fruits and vegetables daily plus chickens and eggs; open Tuesday–Saturday during the May–August growing season.

vegetable-farmpoultry-farmebt-snapmarietta-ga

Gem Orchards

📍 2571 W South Slope Road, Emmett, ID, 83617

in directory

An Idaho fruit orchard in Emmett — Gem County, Boise's western metro area — growing an unusually broad varietal range: 9 cherry varieties (Bing, Rainier, and others), 16+ peach varieties, 7 nectarine varieties, 5 apricot varieties, plus apples, pears, blackberries, and raspberries. Tagline: 'Where Every Fruit Is A Gem.' Member of Idaho Preferred (state quality-and-sourcing program) and Gem County Chamber of Commerce.

orchardcherriespeachesnectarines

Genecco's Farm Market

in directory

Genecco's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Gentile's Market

📍 40 South Newtown Street Road, Newtown Square, PA

in directory

Gentile's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

George's Farm Market

📍 7956 Harford Road, Parkville, MD, 21234

in directory

George's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Georges Mill Farm Store

in directory

Georges Mill Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedgrain-farm

Georgia Bison Company

📍 Greensboro, GA, 30642

in directory

Georgia Bison Company — a Certified Naturally Grown livestock operation in Greensboro, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Georgia Mountain Maples

📍 345 North Road, Milton, VT, 05468

in directory

Georgia Mountain Maples — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Geremiah Farms

in directory

Geremiah Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Germantown Kitchen Garden

0.5 ac

📍 215 East Penn Street, Philadelphia, PA, 19144

in directory

A half-acre urban organic farm + farm stand + plant nursery on East Penn Street in the Germantown neighborhood of Philadelphia. Founded 2009 on a once-abandoned lot, started as a 5-person CSA and grew into a Saturday farm stand and a weekend plant nursery. Solo-operated. Grows kale, lettuce, onions, shallots, garlic, radishes, beets, carrots, currants, and an annually expanding seasonal crop list.

urban-farmfarm-standcsaplant-nursery

Getting's Garden

📍 2861 Pierce Avenue, Sanborn, IA, 51248

in directory

Getting's Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Giardino Foresta

📍 Charlottesville, VA, 22911

in directory

Giardino Foresta — a Certified Naturally Grown produce and flowers operation in Charlottesville, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Gina's Greenhouse

📍 4904 Dysartsville Road, Morganton, NC, 28655

in directory

Gina's Greenhouse — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Glacier View Lavender

in directory

Glacier View Lavender — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

Glade Road Growing

📍 Blacksburg, VA, 24060

in directory

Glade Road Growing — a Certified Naturally Grown produce and flowers operation in Blacksburg, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Glen Meadow Farm

📍 Glenmoore, PA, 19343

in directory

Glen Meadow Farm — a Certified Naturally Grown produce and flowers operation in Glenmoore, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Gless Ranch

📍 Riverside, Coachella Valley, and Kern County, CA (farmer's market: Woodcrest, Riverside)

in directory

Gless Ranch is a Southern California family citrus and tree-fruit operation founded 1958 by John J. Gless and Janet McCandless. Groves of grapefruit, tangerines, limes, lemons, dates, avocados, and figs across Riverside, Coachella Valley, and Kern County; stewardship of historic groves at the California Citrus State Historic Park; farmer's market in Woodcrest since 2017.

citrus-groveorchardmulti-generationalfamily-farm

Gless Ranch

in directory

Gless Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Go Go Grocery Markets

📍 3021 North Gold Star Drive, Long Beach, CA, 90802

in directory

Go Go Grocery Markets — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Goddess Greens

📍 Pandora, OH, 45877

in directory

Goddess Greens — a Certified Naturally Grown produce and flowers operation in Pandora, OH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Godlewsky Farms & Greenhouses

150 ac

📍 196 Alphano Road, Great Meadows, New Jersey 07838 (Pequest Valley, Warren County)

in directory

A 150+ acre family-owned farm and greenhouse operation at 196 Alphano Road in Great Meadows, New Jersey (Warren County), in the Pequest Valley. Three generations on the same land since the 1930s. Horticultural division grows 100+ varieties of annuals, perennials, herbs, vegetable transplants, and hanging baskets; field side grows fresh vegetables and herbs summer through late fall. Runs a Veggie Club share program from mid-June through November and a farmers' market on site.

nurserygreenhousevegetable-transplantscsa

Goebbert's Farm & Garden Center of South Barrington

40 ac

📍 40 West Higgins Road, South Barrington, IL, 60010

in directory

A 40-acre year-round agritourism complex on West Higgins Road in South Barrington, IL — a Chicagoland regional institution operating continuously since 1972. Runs a spring garden center (Apr–Jun), a summer farmer's market (late Jun–Oct), and a Fall Festival (Sept–Oct) with corn mazes, hayrides, pig races, animal interactions, and a famous mechanical pumpkin-eating dinosaur. A working farm at its core with three layered seasonal retail surfaces.

agritourismpumpkin-patchfall-festivalgarden-center

Goebbert's Pumpkin Patch

in directory

Goebbert's Pumpkin Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

GOGNATH EXIM PRIVATE LIMITED

📍 Gujarat, India

in directory

GOGNATH EXIM PRIVATE LIMITED — an NPOP-certified organic operator in Gujarat, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiagujarat

Gold Orchards Inc

📍 14329 East US Highway 290, Stonewall, TX, 78671

in directory

Gold Orchards Inc — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Goldbud Farms

📍 2501 Carson Road, Placeville, CA

in directory

Goldbud Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Golden Hour Herb Farm

📍 Potterville, MI, 48876

in directory

Golden Hour Herb Farm — a Certified Naturally Grown produce and flowers operation in Potterville, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Goldfinch Gardens

📍 Burnsville, NC, 28714

in directory

Goldfinch Gardens — a Certified Naturally Grown produce and flowers operation in Burnsville, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Good Ashe Lavender Farm

📍 Lansing, NC, 28643

in directory

Good Ashe Lavender Farm — a Certified Naturally Grown produce and flowers operation in Lansing, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Good Dog Farm

📍 Upperco, MD, 21155

in directory

Good Dog Farm — a Certified Naturally Grown produce and flowers operation in Upperco, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Good Faith Farm

📍 Flournoy, CA, 96029

in directory

Good Faith Farm — a Certified Naturally Grown produce and flowers operation in Flournoy, CA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Good Find Fungi

📍 Damascus, PA, 18415

in directory

Good Find Fungi — a Certified Naturally Grown mushrooms operation in Damascus, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Good Girl Gladys Farmette

📍 Madison, TN, 37115

in directory

Good Girl Gladys Farmette — a Certified Naturally Grown produce and flowers operation in Madison, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Good Job Bees! Honey House

📍 Kamuela, HI, 96743

in directory

Good Job Bees! Honey House — a Certified Naturally Grown apiary operation in Kamuela, HI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Good Neighbor Farm of Leelanau County

📍 Northport, MI, 49670

in directory

Good Neighbor Farm of Leelanau County — a Certified Naturally Grown produce and flowers operation in Northport, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Good Samaritan Urban Farm

📍 Atlanta, GA, 30318-6653

in directory

Good Samaritan Urban Farm — a Certified Naturally Grown produce and flowers operation in Atlanta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Good Steward Farms

📍 Peyton, CO, 80831

in directory

Good Steward Farms — a Certified Naturally Grown produce and flowers operation in Peyton, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Goodwin creek gardens

in directory

Goodwin creek gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Gopher Glen Apple Farm

📍 2899 See Canyon Road, San Luis Obispo, CA, 93405

in directory

Gopher Glen Apple Farm — a family-owned organic apple orchard in See Canyon, San Luis Obispo, California. The farm's own tagline reads 'Organic farmers make better neighbors' — organic practice is named as the operation's identity, not an option among others.

orchardorganicfamily-ownedsee-canyon

Gorman Farm CSA

📍 10151 Gorman Road, North Laurel, MD, 20723

in directory

A 17-year (since 2008) member-choice CSA farm at 10151 Gorman Road in North Laurel, MD — Howard County, Chesapeake watershed. Operates exclusively as a CSA — no farmstand or farmers-market vending. Currently serves 600+ local families per season. Members select their own produce at weekly farm pickups (rather than receiving fixed boxes). Pick-Your-Own Flower Garden access for members. Active food-donation program to families in need.

csamember-choicesince-2008food-donation

Gorman Farms

in directory

Gorman Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Gorski Apiary

📍 South Kent, CT, 06785

in directory

Gorski Apiary — a Certified Naturally Grown apiary operation in South Kent, CT. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Gospel Flat Farm

📍 140 Olema Bolinas Road

in directory

Gospel Flat Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Gothburg Farms

📍 15203 Sunset Road, Bow, 98232

in directory

Gothburg Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Gotta's Farm & Cider Mill

📍 659 Glastonbury Turnpike, Portland, CT, 06480

in directory

Gotta's Farm & Cider Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Gove Farm

📍 930 Mechanic Street

in directory

Gove Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Gowan's Oak Tree

📍 6600 Highway 128

in directory

Gowan's Oak Tree — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Gowin Valley Farms

📍 Rocky Face, GA, 30740

in directory

Gowin Valley Farms — a Certified Naturally Grown mushrooms operation in Rocky Face, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Grace Farm

📍 Pigeon Forge, TN, 37863

in directory

Grace Farm — a Certified Naturally Grown produce and flowers operation in Pigeon Forge, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Gracious Farm

📍 Gray Court, SC, 29645

in directory

Gracious Farm — a Certified Naturally Grown produce and flowers operation in Gray Court, SC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Gramya Sikshan Paryavaran Sanstha

📍 Uttarakhand, India

in directory

Gramya Sikshan Paryavaran Sanstha — an NPOP-certified organic operator in Uttarakhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttarakhand

Grand Central Station

in directory

Grand Central Station — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Grandad Farms

📍 4270 Hunter's Lane, Emmett, ID, 83617-8629

in directory

Grandad Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Grandad's Apples N' Such

📍 2951 Chimney Rock Road, Hendersonville, NC, 28792

in directory

Grandad's Apples N' Such — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Granny's This and That

📍 312 Southeast Offutt Road, Maysville, MO, 64469-9093

in directory

Granny's This and That — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Grant's Berry Patch

in directory

Grant's Berry Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Grass Roots Farm

📍 Middleburg, PA, 17842

in directory

Grass Roots Farm — a Certified Naturally Grown produce and flowers operation in Middleburg, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Gray Barn Farm Market

📍 1484 Rush-Scottsville Road, Rush, NY, 14543

in directory

Gray Barn Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Gray Fox Farm

📍 Chimacum, WA, 98325

in directory

Gray Fox Farm — a Certified Naturally Grown produce and flowers operation in Chimacum, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Graysmarsh Berry Farm Stand

📍 6187 Woodcock Road, Sequim, WA, 98382

in directory

A large family-owned berry-and-lavender farm on the Sequim Prairie, Clallam County, Washington — Olympic Peninsula. U-pick strawberries, raspberries, boysenberries, blackberries, loganberries, blueberries, plus U-pick lavender. Farm-stand also sells pre-picked berries, jam, lavender, lavender oil, and honey. Stunning Olympic Mountains view from the farm property.

berriesblueberriesraspberriesstrawberries

Great Joy Family Farm

📍 Pine Bush, NY, 12566

in directory

Great Joy Family Farm — a Certified Naturally Grown produce and flowers operation in Pine Bush, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Great Malus Beef

📍 76287 Ege Road, Rainier, OR, 97048

in directory

An Oregon Wagyu operation producing grass-fed beef from a pastured family-of-cattle herd, sold direct-to-eater online by the quarter and as ground-beef shares. Maintains documented animal-welfare protocols (their 'Care Standards') and operates a reservation system that books quarters a year in advance.

livestock-farmwagyugrass-fedpasture-raised

Green Acres Farm Market

📍 15971 Lake Michigan Drive, 49460

in directory

Green Acres Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Green Barn Fruit Co.

📍 599 36 Road, Palisade, CO, 81526

in directory

Green Barn Fruit Co. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Green Box Mushrooms

📍 Gainesville, GA, 30507

in directory

Green Box Mushrooms — a Certified Naturally Grown mushrooms operation in Gainesville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Green Dog Farms

📍 1807 West Vine Drive, Fort Collins, CO

in directory

Green Dog Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Green Eagle Grove

📍 5140 South Ocqueoc Road, Millersburg, MI, 49759

in directory

Green Eagle Grove — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Green Earth Growers

📍 Prior Lake, MN, 55372

in directory

Green Earth Growers — a Certified Naturally Grown produce and flowers operation in Prior Lake, MN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Green Eyed Lady

📍 St. Anne, IL, 60964

in directory

Green Eyed Lady — a Certified Naturally Grown produce and flowers operation in St. Anne, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Green Owl Farm

📍 Rhinebeck, NY, 12572-2544

in directory

Green Owl Farm — a Certified Naturally Grown produce and flowers operation in Rhinebeck, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Green Seed Gardens

📍 Canby, OR, 97013

in directory

Green Seed Gardens — a Certified Naturally Grown produce and flowers operation in Canby, OR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Green String Farm

📍 3571 Old Adobe Road, Petaluma, CA, 94954

in directory

Green String Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Green Supreme

📍 West Middlesex, PA, 16159

in directory

Green Supreme — a Certified Naturally Grown produce and flowers operation in West Middlesex, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Green Thumb

📍 829 Montauk Highway, Water Mill, NY, 11976

in directory

Green Thumb — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Green Thumb Farms Inc

📍 San Juan Bautista, CA, 95045

in directory

Green Thumb Farms Inc — a Certified Naturally Grown produce and flowers operation in San Juan Bautista, CA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Green Tree Farmer’s Market

in directory

Green Tree Farmer’s Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Green Valley Bio Naturals Private Limited

📍 Tamil Nadu, India

in directory

Green Valley Bio Naturals Private Limited — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Green Valley Farm

in directory

Green Valley Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Green Valley Farms

in directory

Green Valley Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

GREEN VALLEY GROWER GROUP

📍 Punjab, India

in directory

GREEN VALLEY GROWER GROUP — an NPOP-certified organic operator in Punjab, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiapunjab

Greene's Trading Post

📍 5361 Blowing Rock Boulevard, Lenoir, 28645

in directory

Greene's Trading Post — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Greener Acres Farm

📍 51 Pleasant Street, 01756

in directory

Greener Acres Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Greenlife Farm

📍 Mentone, IN, 46539

in directory

Greenlife Farm — a Certified Naturally Grown produce and flowers operation in Mentone, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Greensgrow Farmstand

📍 2501 East Cumberland Street, Philadelphia, 19125

in directory

Greensgrow Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Greensgrow Mobile Market

📍 Philadelphia, PA, 19139

in directory

Greensgrow Mobile Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Greenstar Farm

📍 Blacksburg, VA, 24060

in directory

Greenstar Farm — a Certified Naturally Grown produce and flowers operation in Blacksburg, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Greensward Farm

📍 7153 Cooper Point Road, Bozman, MD

in directory

Greensward Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Greensys

📍 Brocton, IL, 61917

in directory

Greensys — a Certified Naturally Grown produce and flowers operation in Brocton, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Greenwood Gardens

📍 5154 US Highway 12, Elma, WA, 98541-9222

in directory

Greenwood Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

GRENERA NUTRIENTS PRIVATE LIMITED

📍 Tamil Nadu, India

in directory

GRENERA NUTRIENTS PRIVATE LIMITED — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Grey Havens Farm

in directory

Grey Havens Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Griffin's Garden

📍 Concord, VA, 24538

in directory

Griffin's Garden — a Certified Naturally Grown produce and flowers operation in Concord, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Griffin's Produce & Flower Shop

in directory

Griffin's Produce & Flower Shop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Griggstown Farm Market

📍 484 Bunker Hill Road, Princeton, NJ, 08540

in directory

Griggstown Farm — a family-owned vertically-integrated farm in Princeton (Somerset County), New Jersey, founded nearly 40 years ago by George and Joan Rude. Raises naturally-grown poultry processed in their own USDA-inspected facility on-site; on-premises kitchen prepares value-added foods from farm production.

poultry-farmnaturally-grownvertically-integratedon-site-processing

Grillin Meats

📍 20134 St Anna Drive, Avon, MN, 56310

in directory

Grillin Meats — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Grism's Sweet Corn

in directory

Grism's Sweet Corn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Grossman Farms

📍 Honesdale, Pennsylvania (Wayne County)

in directory

A naturally-raised beef operation in Honesdale, Pennsylvania (Wayne County). 'Naturally raised' refers to the husbandry standard — pasture-based, no growth hormones, no routine antibiotics — without the formal certifications (USDA Organic, Animal Welfare Approved) that some peer operations carry. Sells direct to customers in the bioregion.

beefnaturally-raisedpasturepennsylvania

Grow A Pear Farm

📍 279 Borough Road, Charlestown, NH, 03603

in directory

Grow A Pear Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Grow Johnson County

📍 Iowa City, IA, 52240

in directory

Grow Johnson County — a Certified Naturally Grown produce and flowers operation in Iowa City, IA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Grow NWA

📍 Bentonville, AR, 72713

in directory

Grow NWA — a Certified Naturally Grown produce and flowers operation in Bentonville, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Grow Where You Are

📍 Atlanta, GA, 30306

in directory

Grow Where You Are — a Certified Naturally Grown produce and flowers operation in Atlanta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Grow with the Flow LLC

📍 Tucker, GA, 30084

in directory

Grow with the Flow LLC — a Certified Naturally Grown produce and flowers operation in Tucker, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Grow2B Farm

📍 Buford, GA, 30519

in directory

Grow2B Farm — a Certified Naturally Grown produce and flowers operation in Buford, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Growing Grounds Farm

in directory

Growing Grounds Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Grown & Made

in directory

Grown & Made — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Grumblethorpe Farmstand

📍 5267 Germantown Avenue, Philadelphia, 19144

in directory

Grumblethorpe Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

GRUNWALD NATURALS

📍 Tamil Nadu, India

in directory

GRUNWALD NATURALS — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

GUIDING GREEN THUMBS LLC

📍 AUSTERLITZ, NY, 12017

in directory

GUIDING GREEN THUMBS LLC — a Certified Naturally Grown produce and flowers operation in AUSTERLITZ, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

GURU JAIVIK UTPADAK SAMITI 2 FDM

📍 Rajasthan, India

in directory

GURU JAIVIK UTPADAK SAMITI 2 FDM — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Hale Family Farm

📍 2521 Highway OO, Farmington, MO, 63640

in directory

Hale Family Farm — a third-generation family farm in Farmington, Missouri, established in the 1940s by William and Edna Hale and now operated by Ron Hale's children. Practices organic agriculture without synthetic chemicals and follows 'Known & Grown' livestock standards prohibiting confinement; produces signature 'pampered tomatoes' and pasture poultry.

organicno-synthetic-chemicalsknown-and-grownmultigenerational

Hale Maluhia Farm LLC

📍 Papaikou, HI, 96781

in directory

Hale Maluhia Farm LLC — a Certified Naturally Grown produce and flowers operation in Papaikou, HI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Half Crown Hill Orchard

📍 600 North Branch Road, McDonald, PA, 15057

in directory

Half Crown Hill Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Hall's Homestead & Gardens

📍 Waycross, GA, 31503

in directory

Hall's Homestead & Gardens — a Certified Naturally Grown produce and flowers operation in Waycross, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hall's Orchards

📍 4422 Main Street, Isle La Motte, VT

in directory

Hall's Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Halsey Farm Sotre

in directory

Halsey Farm Sotre — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hamlet Farm

📍 2691 East Main Street, 14135

in directory

Hamlet Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hana Fruits & Flowers

📍 2840 Hana Highway, Hana, HI, 96713

in directory

A Hawaiian flower farm founded in 1984 in the rainforests of Hana, Maui — growing and shipping fresh tropical flowers (orchids, anthuriums, proteas, leis, tropical arrangements) direct from the islands. The operation maintains partner-farm relationships across multiple Hawaiian microclimates so each flower comes from where it grows best, then ships handpicked and hand-washed directly to the eater.

flower-farmtropicalhawaiianmulti-island

Hand Melon Farm Market

📍 364 State Route 29, Greenwich, NY, 12834

in directory

Hand Melon Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hank's Farmstand

📍 324 County Road 39A, Southampton, NY, 11968

in directory

Hank's Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Hank's Pumpkintown

📍 240 Montauk Highway, Water Mill, NY, 11976

in directory

Hank's Pumpkintown — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hanna's Farm Market

in directory

Hanna's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Hansen's Garden Goodies

📍 82800 River Drive, Creswell, OR, 97426

in directory

Hansen's Garden Goodies — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Happy Tomato Farmstand

in directory

Happy Tomato Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Happy Valley Orchard

📍 217 Quarry Road, Middlebury, VT, 05753

in directory

Happy Valley Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hardler Farm

📍 Honesdale, Pennsylvania (Wayne County)

in directory

A family-operated dairy and meat farm in Honesdale, Pennsylvania (Wayne County), producing raw milk, soft cheeses, yogurt, beef, and pork. Operates as one of the bioregion's verified raw-milk producers under PA's regulated raw-milk permitting framework — meaningful chain-of-custody and food-safety discipline at small farm scale. Distributes through Flood's Nursery & Farm Market in Cresco and other regional aggregator outlets.

dairyraw-milkcheeseyogurt

HARDOOR ESTATE

📍 Karnataka, India

in directory

HARDOOR ESTATE — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Harmony Farm Market

📍 4760 East National Road, springfield, 45505

in directory

Harmony Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Harris Family Farm

📍 Water Valley, MS, 38965

in directory

Harris Family Farm — a Certified Naturally Grown produce and flowers operation in Water Valley, MS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Harris Farm

📍 282 Buzzell Road, Dayton, ME, 04005

in directory

Harris Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hartland Hollow Modern Homestead

📍 54 Walnut Hill Road, East Hartland, CT, 06027

in directory

Hartland Hollow Modern Homestead — a family-owned diversified homestead in East Hartland, Connecticut. Small-scale maple syrup, microgreens, and related farm products grown using organic and natural practices; the operation explicitly frames itself as a 'modern homestead' rather than commercial monoculture.

homesteaddiversified-farmmaple-sugarbushmicrogreens

Harvest Moon Farm & Orchard

📍 134 Hardscrabble Road, North Salem, NY, 10560

in directory

A working farm + orchard + on-site cidery + farm-to-table café in North Salem, NY — Westchester County, the Hardscrabble Road agricultural corridor in the upper Hudson Highlands. Operations include CSA, farm store, café (fresh donuts and baked goods), school tours during apple season, and the on-site Hardscrabble Cider operation. Sources mostly from the farm itself and from nearby Hudson Valley growers.

orchardcsafarm-storecafe

Harvest Moon Garden

📍 Tignall, GA, 30668

in directory

Harvest Moon Garden — a Certified Naturally Grown produce and flowers operation in Tignall, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Harvold Farms

in directory

Harvold Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Harward Farms

📍 2107 North University Avenue, Provo, UT, 84604

in directory

Four-generation Utah farm operating since 1945, growing sweet corn, watermelon, cantaloupe, tomatoes, and peaches alongside certified weed-free hay and straw. Distributes through multiple roadside stands across the Wasatch Front and runs a summer farm camp for kids.

vegetable-farmmulti-generationalsince-1945four-generations

Hauser's Superior View Farm

in directory

Hauser's Superior View Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hawkins Homestead Farm

📍 Dothan, AL, 36305

in directory

Hawkins Homestead Farm — a Certified Naturally Grown produce and flowers operation in Dothan, AL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hayground Farmstand

in directory

Hayground Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hays Century Farm

in directory

Hays Century Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Hayton Farms

in directory

Hayton Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Hayton Farms Berries

📍 16670 Fir Island Road, Mount Vernon, 98273

in directory

Hayton Farms Berries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Hazelnut Pastures

📍 2385 Cleary Road, Brooklet, GA, 30415

in directory

Hazelnut Pastures — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hazelnut Pastures - Rincon Market

📍 201 East Sixth Street, Rincon, GA, 31326

in directory

Hazelnut Pastures - Rincon Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hazelrig Orchards

📍 64241 United States Highway 231, Cleveland, AL, 35049

in directory

Hazelrig Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hazens Blueberry Farm

📍 1144 Peavy Road, Howell, MI

in directory

Hazens Blueberry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Hazlett & Sons Apiary

📍 Fredericksburg, VA, 22406

in directory

Hazlett & Sons Apiary — a Certified Naturally Grown apiary operation in Fredericksburg, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Head Over Fields

in directory

Head Over Fields — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Healthy Harvest Fruits

📍 Stevensville, MT, 59870

in directory

Healthy Harvest Fruits — a Certified Naturally Grown produce and flowers operation in Stevensville, MT. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Heard's Cedar Hill Farm Market

📍 885 Stonewall Jackson Highway, Bentonville, VA, 22610

in directory

Heard's Cedar Hill Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Heart Of Christmas Farms

📍 21310 Fort Christmas Road, Christmas, FL, 32709

in directory

Heart Of Christmas Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hearthstone- Perennials Herbs & Everlastings

in directory

Hearthstone- Perennials Herbs & Everlastings — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Heartland Co-op

📍 306 West 6th Street, Malvern, IA, 51551

in directory

Heartland Co-op — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Heartland Organics

📍 8999 Ridge Road, Gasport, NY, 14067

in directory

Heartland Organics is a 501(c)(3) nonprofit USDA-Organic farm in Gasport, NY (Niagara Frontier), growing organic mushrooms, seasonal vegetables, fruit, and flowers. NOFA-NY member; storefront, online shop, and value-added mushroom line (jerky, tinctures, mushroom coffee).

mushroom-farmvegetable-farmcertified-organicusda-organic

Hearty Hill Farm

📍 Waymart, Pennsylvania (Wayne County)

in directory

A USDA-Organic-certified small farm in Waymart, Pennsylvania (Wayne County), producing certified-organic vegetables, herbs, and cut flowers. USDA Organic certification at small-farm scale is meaningful — the documentation, audit, and recordkeeping requirements are non-trivial, and many small farms operate to organic standards without certifying because the paperwork burden outweighs the marketing premium. Hearty Hill's certification puts them in the verifiable third-party-audited tier of the bioregion's small-farm food system.

vegetablesherbscut-flowersorganic-certified

Heckman Orchards

📍 Effort, Pennsylvania (Polk Township, Monroe County)

in directory

A multi-generation family-owned apple orchard, farm market, and bakery in Effort, Pennsylvania (Polk Township, Monroe County), on the southern flank of the Pocono Plateau. The orchard has operated continuously since the 1930s and grows a wide range of apple varieties — including modern commercial cultivars and a few heritage varieties — alongside seasonal small-fruit and vegetable production. The farm market, open spring through Christmas, sells the orchard's apples, fresh and pressed cider, baked goods, and seasonal produce. One of the bioregion's reliable family-farm operations and a working illustration that small-orchard agriculture remains viable on Pocono-edge ground when the farm-to-customer relationship runs through a direct retail surface.

orchardapplefamily-farmpennsylvania

Hedge Family Farm

📍 Happy Valley, NC, 28645

in directory

Hedge Family Farm — a Certified Naturally Grown produce and flowers operation in Happy Valley, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hedge Rose Farm

📍 Halfway, OR, 97834

in directory

Hedge Rose Farm — a Certified Naturally Grown produce and flowers operation in Halfway, OR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hedlin's Family Farm

📍 12052 Chilberg Road, La Conner, WA, 98257

in directory

Hedlin's Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Heeler Farms LLC

📍 Pine Plains, NY, 12567

in directory

Heeler Farms LLC — a Certified Naturally Grown produce and flowers operation in Pine Plains, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Heidi's Farmstand & Bakery

in directory

Heidi's Farmstand & Bakery — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Heikes Berry Farm

in directory

Heikes Berry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Heinie's Market

📍 11801 West 44th Avenue, Wheat Ridge, CO, 80033

in directory

Heinie's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Heirloom Acres NOTL

📍 Niagara-On-The-Lake, ON, L0S1J0

in directory

Heirloom Acres NOTL — a Certified Naturally Grown produce and flowers operation in Niagara-On-The-Lake, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Heirloom Gardens

📍 Dahlonega, GA, 30533

in directory

Heirloom Gardens — a Certified Naturally Grown produce and flowers operation in Dahlonega, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hellbender Farm

📍 Lansing, NC, 28643

in directory

Hellbender Farm — a Certified Naturally Grown produce and flowers operation in Lansing, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Helvetia Lavender Farm

in directory

Helvetia Lavender Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

HEMI Blueberry Farm

📍 Greensboro, GA, 30642

in directory

HEMI Blueberry Farm — a Certified Naturally Grown produce and flowers operation in Greensboro, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Henry Got Crops!

📍 7095 Henry Avenue, Philadelphia, 19129

in directory

Henry Got Crops! — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Herbert's Market

📍 372 US 9, Waretown, NJ, 08758

in directory

Herbert's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Heritage Farm at the Howell Family Homestead

📍 Waymart, Pennsylvania (Wayne County)

in directory

A raw-milk dairy operation at the Howell family homestead in Waymart, Pennsylvania (Wayne County). Operates under PA's permitted raw-milk framework — meaningful chain-of-custody discipline at small farm scale. One of several Wayne County family farms holding raw-milk permits and serving the bioregion's growing direct-relationship dairy market.

raw-milkdairyfamily-homesteadpennsylvania

Heritage Farm Farmstand

📍 4300 Monument Road, Philadelphia, PA, 19131

in directory

Methodist Services urban farm in West Philadelphia growing chemical-free produce for women and children in residential programs since 2011, with four high tunnels extending the Philly growing season.

vegetable-farmurban-farmfood-accessphiladelphia

Herman's Farm Market & Cider Mill

📍 741 Five Mile Line Road, Webster, NY, 14580

in directory

Herman's Farm Market & Cider Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Herold's Farm Market

📍 2373 Sans Souci Parkway, Wilkes-Barre, PA, 18706

in directory

Herold's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Herrick Farms

📍 88088 Millican Road, Springfield, OR, 97478

in directory

Herrick Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hessey Farmstead, LLC

📍 Hartford, MI, 49057

in directory

Hessey Farmstead, LLC — a Certified Naturally Grown produce and flowers operation in Hartford, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hickory Creek Lavender Farm

📍 Stevensville, MI, 49127

in directory

Hickory Creek Lavender Farm — a Certified Naturally Grown produce and flowers operation in Stevensville, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hickory Hill Lavender

📍 Hiwassee, VA, 24347

in directory

Hickory Hill Lavender — a Certified Naturally Grown produce and flowers operation in Hiwassee, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hickory Ridge Orchard

📍 24688 Audrain Rd 820, Mexico, MO, 65265

in directory

Hickory Ridge Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hidden Acres

📍 10645 West 425 South, Wilkinson, IN, 46186

in directory

Hidden Acres Fruit Farm — a family-owned chemical-free farm in Wilkinson, Indiana. The operating principle is stated plainly: 'If we can't drink or eat it, our plants don't either.' Hand-picked harvests, soil-health-focused practices, no synthetic chemicals (no USDA Organic certification, but explicit chemical-free commitment).

chemical-freefamily-ownedhand-pickedsoil-health

Hidden Hills Orchard

📍 5680 Ohio Highway 26, Marietta, OH, 45750

in directory

Hidden Hills Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hidden Valley Orchards

in directory

Hidden Valley Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Highland Farm

📍 Honesdale, Pennsylvania (Wayne County)

in directory

A multi-generation family dairy farm in Honesdale, Pennsylvania, in continuous operation since 1841. Produces milk that feeds the on-farm Calkins Creamery cheese operation — one of the bioregion's clearest cases of a 200-year farm continuity sustained through value-add diversification. The farm's longevity puts it in the same conceptual layer as Decker Farm on Staten Island and Quiet Valley Living Historical Farm: bioregional continuity expressed through working operation rather than static preservation.

dairymulti-generationheritagepennsylvania

Highview Farms Meat Market

📍 1555 Kerr Road, Whiteford, MD, 21160

in directory

Highview Farms Meat Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Hill City Mushrooms

📍 127 Orrix Creek Road, Evington, VA, 24550

in directory

Hill City Mushrooms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmushroom-farm

Hillcrest Orchards

📍 560 South Maine Street, Winterport, ME, 04496

in directory

Hillcrest Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hillcrest Orchards Farm Market

📍 9696 GA 52, Ellijay, GA, 30536

in directory

Hillcrest Orchards Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hillegas Sugar Camp

📍 455 Dividing Ridge Road, Fairhope, PA, 15538

in directory

A 20+ year Pennsylvania maple-syrup producer at 455 Dividing Ridge Road in Fairhope, PA — Bedford County, southwestern Pennsylvania highlands. Produces multiple grades of pure PA maple syrup (golden, amber, dark, very dark), plus maple candy, maple BBQ sauce, maple-coated nuts (walnuts and peanuts), and a maple walnut topping. Family-scale operation.

maple-sugarbushmaple-syruppennsylvania-maplesince-2005

Hillsborough Farm Market

📍 219 Hillsborough Road

in directory

Hillsborough Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Hillside Farmstand

in directory

Hillside Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hillside Orchards

📍 7209 State Route 819, Mount Pleasant, PA, 15666

in directory

Hillside Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hillstead Farm

📍 Honesdale, Pennsylvania (Wayne County)

in directory

A small Honesdale, Pennsylvania (Wayne County) farm producing eggs from laying hens and seasonal vegetable produce. The egg-and-produce pairing is one of the most accessible small-farm configurations: low capital requirements, manageable labor demands, and reliable direct-sale demand at farmers markets and farm stands.

eggsvegetablesfamily-farmpennsylvania

Hilltop Hanover Farm and Environmental Center

187 ac

📍 Yorktown Heights, NY (Westchester County)

in directory

187-acre Westchester County–owned working farm and environmental center in the southern Hudson Highlands. Operates as a regenerative-agriculture demonstration site, regional-food producer, and public-education campus. Saved from development in 2003 when Westchester County purchased the property; today managed in partnership with the Hilltop Hanover Farm Foundation. Programs: a pick-your-own season, weekly farm stand, CSA, school and youth education programs, beginner-farmer training, soil-health research plots, and a public trail network. A useful counter-example to the assumption that regenerative agriculture is a private-sector-only undertaking — this is a publicly-owned working farm in one of the country's wealthiest counties.

public-landregenerative-agricultureeducationhudson-highlands

Hilltop Hanover Farm Market

in directory

Hilltop Hanover Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Hillview Farms

📍 223 Meyersville Road, Gillette

in directory

Hillview Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hindinger Farm Store

in directory

Hindinger Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hinterland Farm and Kitchen

📍 Pullman, MI, 49450-9606

in directory

Hinterland Farm and Kitchen — a Certified Naturally Grown produce and flowers operation in Pullman, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hobbit House

in directory

Hobbit House — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Hobo Hollar Farms

📍 124 Old Converse Road, Spartanburg, SC, 29307

in directory

Hobo Hollar Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hoffman Appalachian Farm

📍 St. Marys, PA, 15857

in directory

Hoffman Appalachian Farm — a Certified Naturally Grown produce and flowers operation in St. Marys, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hoffman Farms Store

📍 22242 Southwest Scholls Ferry Road, Beaverton, OR, 97007

in directory

Hoffman Farms Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Hoffman Greenhouses

📍 Mundelein, IL, 60060

in directory

Hoffman Greenhouses — a Certified Naturally Grown produce and flowers operation in Mundelein, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hole in the Woods Farm

📍 Culver, IN, 46511

in directory

Hole in the Woods Farm — a Certified Naturally Grown produce and flowers operation in Culver, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Holiday Farm

in directory

Holiday Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Hollar & Greene Produce Co

📍 230 Cabbage Row Drive, Boone, NC, 28607

in directory

Hollar & Greene Produce Co — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Holleydale Farms & Gardens

in directory

Holleydale Farms & Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Holmberg Orchards

📍 1990 Route 12, Ledyard, CT, 06335

in directory

Holmberg Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Homegrown Direct LLC

📍 130 Old Farm Road, Georgetown, KY, 40324

in directory

Eighth-generation Kentucky family farm (230 acres) that transformed an inherited tobacco operation into a diversified produce CSA, wholesale, and registered Angus beef operation. USDA GAP+ certified and a Kentucky Department of Agriculture LFPA program partner.

vegetable-farmcsamulti-generationaleighth-generation

Homestead Farm

📍 15604 Sugarland Road, Poolesville, MD, 20837

in directory

An Allnutt-family pick-your-own farm and market at 15604 Sugarland Road in Poolesville, MD — Montgomery County, the Sugarloaf Mountain agricultural reserve. Seasonal pick-your-own produce and orchard operation. Closed for winter, reopens in June. Strict on-farm policies (no pets, no birthday parties, no professional photography, no checks) signal a deliberate production-first orientation rather than agritourism-first.

family-farmallnutt-familyu-pickorchard

Homestead Gardens

📍 77065 State Highway 13, Washburn, WI, 54891

in directory

Homestead Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hometown Microgreens

📍 Freehold, NJ, 07728

in directory

Hometown Microgreens — a Certified Naturally Grown produce and flowers operation in Freehold, NJ. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Honest Dirt Market Garden

📍 Fayetteville, AR, 72704

in directory

Honest Dirt Market Garden — a Certified Naturally Grown produce and flowers operation in Fayetteville, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Honey Moon Farms

📍 Adkins, TX, 78101

in directory

Honey Moon Farms — a Certified Naturally Grown apiary operation in Adkins, TX. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Honey Pot Hill Orchards Farm Store

in directory

Honey Pot Hill Orchards Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Honey Stand

in directory

Honey Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Honey Tree Farm

📍 Conover, NC, 28613

in directory

Honey Tree Farm — a Certified Naturally Grown produce and flowers operation in Conover, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

HoneyBear Growers

📍 15 Honeybear Lane, Brewster, WA, 98812

in directory

HoneyBear Growers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Honeycomb Creek Farm

📍 3001 Moyer Road

in directory

Honeycomb Creek Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Hoover's Farm Market & Greenhouses

📍 1719 Main Street, East Earl, PA

in directory

Hoover's Farm Market & Greenhouses — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hope Farm

📍 Weirsdale, FL, 32195

in directory

Hope Farm — a Certified Naturally Grown produce and flowers operation in Weirsdale, FL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hopping Rabbit Farm

📍 5799 Cuneo Road, Coulterville, CA, 95311

in directory

Hopping Rabbit Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Horse Drawn Farm

in directory

Horse Drawn Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Hourglass Tree Farms

📍 Shirley, AR, 72153

in directory

Hourglass Tree Farms — a Certified Naturally Grown produce and flowers operation in Shirley, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Howard's Apple

📍 9575 Bainbridge Road, Chagrin Fall, OH, 44023

in directory

Howard's Apple — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Howe's Farm&Garden

📍 2443 Pleasant Street, Paxton

in directory

Howe's Farm&Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Howlands Feed Mill / Store

in directory

Howlands Feed Mill / Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Howling Pines Tree Farm

in directory

Howling Pines Tree Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

Huasna Farms

📍 2520 Lopez Drive, CA

in directory

Huasna Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hubbell Farms

📍 6620 East M 72, Williamsburg, MI, 49690

in directory

Hubbell Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hudson Farms

in directory

Hudson Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hudson's Apple House

📍 8036 GA 52, Ellijay, GA, 30536

in directory

Hudson's Apple House — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hudson's Farm Fresh

in directory

Hudson's Farm Fresh — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Hugick Farms LLC

📍 Mohawk, NY, 13407

in directory

Hugick Farms LLC — a Certified Naturally Grown produce and flowers operation in Mohawk, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Humbleweed Farm

📍 Champaign, IL, 61820

in directory

Humbleweed Farm — a Certified Naturally Grown produce and flowers operation in Champaign, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hump Mountain Apple House

📍 46 Buck Mountain Road, Elk Park, NC, 28622

in directory

Hump Mountain Apple House — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hungry Chicken Country Store

in directory

Hungry Chicken Country Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Hunt Road Berry Farm

📍 West Brookfield, MA, 01585

in directory

Hunt Road Berry Farm — a Certified Naturally Grown produce and flowers operation in West Brookfield, MA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Hurd Orchards

📍 17260 Ridge Road, Holley, NY, 14470

in directory

A multi-generation family farm and orchard at 17260 Ridge Road in Holley, NY — Orleans County, Niagara Frontier farm country east of Buffalo. Family operation across multiple generations. Member of Red Tomato — the Northeast nonprofit produce-marketing label that verifies 'righteous produce' farming standards. Pick-your-own berries, stone fruit, and apples; 18th-century farmhouse hosts seasonal luncheons and culinary dinners; floral workshops; handcrafted gift collections made on-site.

orchardfamily-farmred-tomato-memberrighteous-produce

Hurds Family Farm

📍 2189 State Route 32, Modena, NY, 12548

in directory

Hurds Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Huron Farm Market

in directory

Huron Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Hyldemoer + Co.

📍 Chiefland, FL, 32626

in directory

Hyldemoer + Co. — a Certified Naturally Grown produce and flowers operation in Chiefland, FL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

ʻĀina Momona

📍 Keawanui Fishpond, Kaʻamola, Molokaʻi, HI

in directory

ʻĀina Momona is a Native Hawaiian-led nonprofit on Molokaʻi dedicated to restoring social justice and food sovereignty through traditional fishpond mariculture and ahupuaʻa-based agriculture.

direct-from-farmosm-verifiedhawaiimolokai

Iatreilang Organic Producers Cooperative Society Ltd (ICS- I)

📍 Meghalaya, India

in directory

Iatreilang Organic Producers Cooperative Society Ltd (ICS- I) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Iatreilang Organic Producers Cooperative Society Ltd. (ICS- II)

📍 Meghalaya, India

in directory

Iatreilang Organic Producers Cooperative Society Ltd. (ICS- II) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Idaho Aquaponics

in directory

Idaho Aquaponics — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Illinois Country Harvest

📍 Prairie du Rocher, IL, 62277

in directory

Illinois Country Harvest — a Certified Naturally Grown produce and flowers operation in Prairie du Rocher, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Imperial's Garden

in directory

Imperial's Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Indian Creek Farm

📍 1408 Trumansburg Road, Ithaca, NY, 14850

in directory

Indian Creek Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Indian Institute of Organics

📍 Rajasthan, India

in directory

Indian Institute of Organics — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Indian Ladder Farms

in directory

Indian Ladder Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Indian Line Farm

📍 Great Barrington, MA, 01230

in directory

Indian Line Farm — a Certified Naturally Grown produce and flowers operation in Great Barrington, MA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Indian Products Private Limited

📍 Tamil Nadu, India

in directory

Indian Products Private Limited — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Indian River Fruit Company

in directory

Indian River Fruit Company — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

INDO TURMERIPEP PRIVATE LIMITED

📍 Kerala, India

in directory

INDO TURMERIPEP PRIVATE LIMITED — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Ingex Botanicals Private Limited

📍 Karnataka, India

in directory

Ingex Botanicals Private Limited — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Ingram Farmstand

in directory

Ingram Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Iniyadavan Organic Estates Private Limited

📍 Tamil Nadu, India

in directory

Iniyadavan Organic Estates Private Limited — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

INNOVATIVE CUISINE PRIVATE LIMITED

📍 Gujarat, India

in directory

INNOVATIVE CUISINE PRIVATE LIMITED — an NPOP-certified organic operator in Gujarat, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiagujarat

Integrated Food Park Limited

📍 Karnataka, India

in directory

Integrated Food Park Limited — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Interlochen Center for the Arts

📍 Interlochen, MI, 49643

in directory

Interlochen Center for the Arts — a Certified Naturally Grown produce and flowers operation in Interlochen, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

INTERNATIONAL AGRICULTURAL PROCESSING PRIVATE LIMITED

📍 Tamil Nadu, India

in directory

INTERNATIONAL AGRICULTURAL PROCESSING PRIVATE LIMITED — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Irie Farm Mushroom Company

📍 Gresham, OR, 97080

in directory

Irie Farm Mushroom Company — a Certified Naturally Grown mushrooms operation in Gresham, OR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Irin Wellness Inc. (Holistic Family Farm)

📍 Latham, NY, 12110

in directory

Irin Wellness Inc. (Holistic Family Farm) — a Certified Naturally Grown produce and flowers operation in Latham, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Isham Family Farm

📍 3466 Oak Hill Road, Williston, VT

in directory

Isham Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Island Health Farmstand

in directory

Island Health Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmushroom-farm

Isom's Orchard Athens Farm

📍 24012 US Highway 72, Athens, AL, 35613

in directory

Isom's Orchard Athens Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

It's Giving Farm

📍 Uxbridge, ON, L9P 0G7

in directory

It's Giving Farm — a Certified Naturally Grown produce and flowers operation in Uxbridge, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

J L Knight Family Farm

📍 319 Goode Street, Burnt Hills, NY, 12027

in directory

J L Knight Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

J's Farm Market

📍 2115 Waverly Drive, Bel Air, MD, 21015

in directory

J's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

J&A Farm

📍 Goshen, NY, 10924

in directory

J&A Farm — a Certified Naturally Grown produce and flowers operation in Goshen, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

J&P's Farm Market

in directory

J&P's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Jack's Farm Market

in directory

Jack's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Jacob Weikert Farm

in directory

Jacob Weikert Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Jacobson Family Farms

📍 Antioch, IL, 60002

in directory

Jacobson Family Farms — a Certified Naturally Grown produce and flowers operation in Antioch, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

JAGDAMBA SHENDRIY SHETI SANSTHA

📍 Maharashtra, India

in directory

JAGDAMBA SHENDRIY SHETI SANSTHA — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

JALINGA TEA CO (INDIA) PRIVATE LIMITED

📍 West Bengal, India

in directory

JALINGA TEA CO (INDIA) PRIVATE LIMITED — an NPOP-certified organic operator in West Bengal, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiawest-bengal

JALINGA TEA CO. (INDIA) PVT LTD

📍 West Bengal, India

in directory

JALINGA TEA CO. (INDIA) PVT LTD — an NPOP-certified organic operator in West Bengal, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiawest-bengal

JALINGA TEA COMPANY (I) PVT LTD

📍 Assam, India

in directory

JALINGA TEA COMPANY (I) PVT LTD — an NPOP-certified organic operator in Assam, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiaassam

Jamber Acres

📍 Cotopaxi, CO, 81223

in directory

Jamber Acres — a Certified Naturally Grown produce and flowers operation in Cotopaxi, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Jandt Fams

in directory

Jandt Fams — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Jara Farms

in directory

Jara Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Jashinsky Farms

in directory

Jashinsky Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Jasper Hill Farm

📍 Greensboro, Vermont, USA

in directory

A Vermont raw-milk cheesemaker in Greensboro, in the Northeast Kingdom — produces 14 distinct cheese varieties from their own herd and ages partner cheesemakers' cheeses in the 22,000-square-foot Cellars at Jasper Hill, paying partner farms approximately three times commodity-milk prices via the value-add of cheese and affinage.

cheeseraw-milkaffinagecellars-at-jasper-hill

Jaswell’s Farm

📍 50 Swan Road, 02917

in directory

Jaswell’s Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

JB Family Growers

in directory

JB Family Growers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

JC Farms & Greenhouses

in directory

JC Farms & Greenhouses — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

JEEVA ORGANIC PRIVATE LIMITED

📍 Madhya Pradesh, India

in directory

JEEVA ORGANIC PRIVATE LIMITED — an NPOP-certified organic operator in Madhya Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamadhya-pradesh

JEEVAGRAM ORGANICS INDIA PRIVATE LIMITED

📍 Kerala, India

in directory

JEEVAGRAM ORGANICS INDIA PRIVATE LIMITED — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Jeff-Roe's

in directory

Jeff-Roe's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Jems Haven: Jems Utilities & Farm Services

📍 1134 Old River Road, Harvard, ID, 83834

in directory

Jems Haven: Jems Utilities & Farm Services — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Jenny's Farm Market

in directory

Jenny's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Jericho Settlers Farm

📍 22 Barber Farm Road, Jericho, VT, 05465

in directory

A year-round certified-organic diversified vegetable-and-livestock farm in Jericho, Vermont — Champlain Valley. Vermont Organic + Real Organic certified vegetable production, pasture-raised chicken and pork on non-GMO feed, grass-fed and grass-finished beef, farm-fresh eggs. Year-round CSA with pickup locations across Chittenden County (Burlington, Richmond, Jericho, Williston, Waterbury), on-site farmstand daily 8 am – 6 pm, wholesale to area restaurants, institutions, and grocers.

certified-organicreal-organiccsafarm-stand

Jerod Baker Sr Packing Shed

📍 1116 Ben Baker Road, Ellenton, GA, 31747

in directory

Jerod Baker Sr Packing Shed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Jerry's Farm Market

in directory

Jerry's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

JHARKHAND ORGANIC GROWER GROUP - ICCOA- KOLEBIRA

in directory

JHARKHAND ORGANIC GROWER GROUP - ICCOA- KOLEBIRA — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

JHARKHAND ORGANIC GROWER GROUP - ICCOA- PAKARDANR

📍 Jharkhand, India

in directory

JHARKHAND ORGANIC GROWER GROUP - ICCOA- PAKARDANR — an NPOP-certified organic operator in Jharkhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiajharkhand

JHARKHAND ORGANIC GROWER GROUP - ICCOA- SIMDEGA

📍 Jharkhand, India

in directory

JHARKHAND ORGANIC GROWER GROUP - ICCOA- SIMDEGA — an NPOP-certified organic operator in Jharkhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiajharkhand

JHARKHAND ORGANIC GROWER GROUP (NPOP) -LAPUNG

📍 Jharkhand, India

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP) -LAPUNG — an NPOP-certified organic operator in Jharkhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiajharkhand

JHARKHAND ORGANIC GROWER GROUP (NPOP) BAGHMARA 01

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP) BAGHMARA 01 — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

JHARKHAND ORGANIC GROWER GROUP (NPOP) BAGHMARA-02

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP) BAGHMARA-02 — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

JHARKHAND ORGANIC GROWER GROUP (NPOP) CHANDWA

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP) CHANDWA — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

JHARKHAND ORGANIC GROWER GROUP (NPOP) CHANDWA- LATEHAR

📍 Jharkhand, India

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP) CHANDWA- LATEHAR — an NPOP-certified organic operator in Jharkhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiajharkhand

JHARKHAND ORGANIC GROWER GROUP (NPOP) NAGRI-02

📍 Jharkhand, India

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP) NAGRI-02 — an NPOP-certified organic operator in Jharkhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiajharkhand

JHARKHAND ORGANIC GROWER GROUP (NPOP) TOPCHANCHI

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP) TOPCHANCHI — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

JHARKHAND ORGANIC GROWER GROUP (NPOP)- PATHNA-01

📍 Jharkhand, India

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP)- PATHNA-01 — an NPOP-certified organic operator in Jharkhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiajharkhand

JHARKHAND ORGANIC GROWER GROUP (NPOP)- PATHNA-02

📍 Jharkhand, India

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP)- PATHNA-02 — an NPOP-certified organic operator in Jharkhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiajharkhand

JHARKHAND ORGANIC GROWER GROUP (NPOP)-NAGRI-01

📍 Jharkhand, India

in directory

JHARKHAND ORGANIC GROWER GROUP (NPOP)-NAGRI-01 — an NPOP-certified organic operator in Jharkhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiajharkhand

JIGYASHA GROWER GROUP

📍 Punjab, India

in directory

JIGYASHA GROWER GROUP — an NPOP-certified organic operator in Punjab, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiapunjab

JIYA JAIVIK KISHAN SEVA SAMITI SILLI

📍 Rajasthan, India

in directory

JIYA JAIVIK KISHAN SEVA SAMITI SILLI — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Joe's Brook Farmstand

in directory

Joe's Brook Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Joe's Farm Market

📍 11072 Main Street, Clarence, NY, 14031

in directory

Joe's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

JoesNuts

📍 84-5180 Painted Church Road, Captain Cook, HI

in directory

JoesNuts — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Johnson Family Produce and General Store

📍 407 US 15, US 501, Carthage, NC, 28327

in directory

Johnson Family Produce and General Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Johnson Farms

📍 58 West 400 North, Logan, UT, 84341

in directory

Johnson Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Johnson Golden Harvest

📍 412 West River Road, Hooksett, NH, 03106

in directory

Johnson Golden Harvest — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Johnson's Corner Farm

📍 133 Church Rd

in directory

Johnson's Corner Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Jolly Farmers

in directory

Jolly Farmers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Jones Family Farm Market

📍 2100 Philadelphia Road, Edgewood, MD, 21040

in directory

A two-location Maryland family farm running U-pick strawberries, pumpkins, and Christmas trees plus an on-farm greenhouse with vegetable transplants and handmade planters. Maryland's Best certified. Operates a CSA with multiple pickup points including the Rotunda Farmers Market in Baltimore. Accepts WIC, Senior Farmers' Market Nutrition Program coupons, and EBT — meaningful food-access alignment for a directory operation.

vegetable-farmfamily-farmcsafood-access

Jones Family Greens

📍 Eden Mills, ON, N0B 1P0

in directory

Jones Family Greens — a Certified Naturally Grown produce and flowers operation in Eden Mills, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Josie Porter Farm

48 ac

📍 Stroudsburg, Pennsylvania (Monroe County)

in directory

A 48-acre biodynamic and organic vegetable farm in Stroudsburg, Pennsylvania, in the Cherry Valley foothills of the Poconos. Operates Cherry Valley CSA, treating the farm as a single living organism in the biodynamic tradition. One of the bioregion's clearest examples of small-scale, living-soil vegetable production.

biodynamicorganiccsapennsylvania

Jubilee Fruits and Vegetables

in directory

Jubilee Fruits and Vegetables — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Jujo Fruit & Scoop

in directory

Jujo Fruit & Scoop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Just Picked Farm, LLC

📍 Montpelier, VA, 23192

in directory

Just Picked Farm, LLC — a Certified Naturally Grown produce and flowers operation in Montpelier, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

JYOT ORGANICS

in directory

JYOT ORGANICS — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

JYOT ORGANICS

📍 Rajasthan, India

in directory

JYOT ORGANICS — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

K. Farm

📍 102 Exeter Road, Kingston, NH

in directory

K. Farm — a multigenerational regenerative farm in Kingston, New Hampshire, originally established in 1758 as King Farm and now in its third family generation under Nell and Andy Fillmore. Pasture-raised cattle, pigs, chickens, and goats; the farm names regenerative agriculture and animal welfare as its operating principles.

livestock-farmregenerativepasture-raisedmulti-species

K&B Liberty Farms

📍 2254 Nature Lane Southeast, Corydon, IN, 47112

in directory

K&B Liberty Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Kajers Greens LLC

📍 North Judson, IN, 46366

in directory

Kajers Greens LLC — a Certified Naturally Grown produce and flowers operation in North Judson, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

KALAASHA ORGANICS

📍 Rajasthan, India

in directory

KALAASHA ORGANICS — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Kaleido Greens

📍 Kildeer, IL, 60047

in directory

Kaleido Greens — a Certified Naturally Grown produce and flowers operation in Kildeer, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Kalinga Agro Grower Group, Udaipur

📍 Rajasthan, India

in directory

Kalinga Agro Grower Group, Udaipur — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Kalir Farms

in directory

Kalir Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Kalon Farms

in directory

Kalon Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Kalopa Fields Farmstead

📍 44-2580 Kalopa Road, Honoka'a, HI 96727 (Hāmākua coast, Big Island)

in directory

Kalopa Fields Farmstead is a small regenerative family farm and homestead in Honoka'a on the Hāmākua coast of Hawai'i (Big Island), growing organic seasonal vegetables and producing artisan breads and handcrafted herbal products (salves, soaps, teas) from local and organic ingredients.

regenerativeorganicfamily-farmhawaii

Kalpataru Neera Farm

in directory

Kalpataru Neera Farm — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Kalpavruksha Farm

The 14-acre coconut-and-chikoo polyculture farm in Umbergaon, Gujarat, India, built by Bhaskar Save ('the Gandhi of natural farming') from the early 1950s until his death in 2015. The name is Sanskrit for 'wish-fulfilling tree.' Approximately 10 acres of mixed natural orchard — coconut and chikoo (sapota) as the canopy crops, with interplanted papaya, banana, mango, drumstick, and a thick understory of medicinal and culinary herbs — plus roughly 2 acres in seasonal rotation field crops. The farm produces commercial volumes with essentially no external inputs: no purchased fertilizer, no purchased pesticide, minimal labor, no irrigation in most years. Soil is dark and humic, perpetually mulched by the orchard's own leaf-fall. The water table has risen across the decades. Masanobu Fukuoka, visiting in 1996, called Kalpavruksha 'the best [farm] in the world,' ahead of his own Shikoku farm. It is one of the most-visited working examples of tropical natural farming on Earth and a substrate-builder reference operation for any 0mn1.one work in tropical/subtropical bioregions.

indiagujaratnatural-farmingpolyculture

Kanani Farms

in directory

Kanani Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Kankakee Valley Homestead

📍 Walkerton, IN, 46574

in directory

Kankakee Valley Homestead — a Certified Naturally Grown produce and flowers operation in Walkerton, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

KARN BHOOMI KISAN UTPADAK SWAYAT SAHKARITA

📍 Uttarakhand, India

in directory

KARN BHOOMI KISAN UTPADAK SWAYAT SAHKARITA — an NPOP-certified organic operator in Uttarakhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttarakhand

KasaHoney

📍 Charlotte, NC, 28278

in directory

KasaHoney — a Certified Naturally Grown apiary operation in Charlotte, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Kat The Farmer

📍 Check, VA, 24072

in directory

Kat The Farmer — a Certified Naturally Grown produce and flowers operation in Check, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Katie Bee Honey Co.

📍 Athens, GA, 30606

in directory

Katie Bee Honey Co. — a Certified Naturally Grown apiary operation in Athens, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Kattula Family Farms

📍 Gainesville, GA, 30506

in directory

Kattula Family Farms — a Certified Naturally Grown produce and flowers operation in Gainesville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Kaufman Family Farms

📍 Murrayville, GA, 30564

in directory

Kaufman Family Farms — a Certified Naturally Grown produce and flowers operation in Murrayville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Kellogg's Supply

📍 45 South Hwy 59, Merced, 95341

in directory

Kellogg's Supply — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Kennett Square Specialties

in directory

Kennett Square Specialties — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmushroom-farm

Kerbyville farm

in directory

Kerbyville farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Kercher Sunrise Orchards Inc

in directory

Kercher Sunrise Orchards Inc — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Kerns Quality Meats

📍 9007 Coyne Station Road, Huntley, IL, 60142

in directory

Kerns Quality Meats — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Keswick Plantation

in directory

Keswick Plantation — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Khalsa Family Farms

📍 Espanola, NM, 87532

in directory

Khalsa Family Farms — a Certified Naturally Grown produce and flowers operation in Espanola, NM. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Khang's Family Farm

📍 Jackson, WI, 53037

in directory

Khang's Family Farm — a Certified Naturally Grown produce and flowers operation in Jackson, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Khliehriat Organic Producers Cooperative Society Ltd

in directory

Khliehriat Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Khliehriat Organic Producers Cooperative Society Ltd (Group I)

in directory

Khliehriat Organic Producers Cooperative Society Ltd (Group I) — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Kidder Farm Market

📍 4374 West Fairmount Avenue, Lakewood, NY, 14750

in directory

Kidder Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Kielbasa Orchards

📍 290 Bay Road

in directory

Kielbasa Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Killam and Bassette Farmstead

📍 1098 Main Street, Glastonbury, CT, 06073

in directory

A South Glastonbury, Connecticut farm operating on the same land since 1893 — over 130 years of continuous family agriculture in the Connecticut River Valley. USDA-certified pork and chicken, free-range eggs, vegetables, and award-winning canned goods. Three CSA programs, 18 seasonal farmers-market routes, on-farm dinners, and a Mother's-Day-to-December-31 farmstand open every day.

livestock-farmmulti-generationalcentury-farmcertified-meat

Killer Tomato Stand

📍 1914 Pamo Road, Ramona, CA, 92065

in directory

Killer Tomato Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Kin Farm

📍 6427 Simonelli Road, Whitehall, MI, 49461

in directory

Kin Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Kind Organics Inc

📍 Alliston, ON, L9R 1V1

in directory

Kind Organics Inc — a Certified Naturally Grown produce and flowers operation in Alliston, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

King Brothers Dairy

in directory

King Brothers Dairy — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

King George Feed and Supply

📍 10312 Indiantown Road

in directory

King George Feed and Supply — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

King's Korner

📍 Highway 378, Lexington, SC, 29072

in directory

King's Korner — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Kinloch Farm Inc.

📍 The Plains, VA, 20198

in directory

Kinloch Farm Inc. — a Certified Naturally Grown apiary operation in The Plains, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

KISAAN PARIVAR LIMITED

📍 Telangana, India

in directory

KISAAN PARIVAR LIMITED — an NPOP-certified organic operator in Telangana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatelangana

Kiyokawa Family Orchards

📍 5625 Hutson Drive, Mt Hood / Parkdale, OR, 97041

in directory

Kiyokawa Family Orchards is a Japanese-American family fruit operation in Parkdale, OR (Hood River Valley), farming since 1911 — the Kiyokawas were among the few Japanese-American Hood River families to return and rebuild after WWII internment at Tule Lake. Today: 125+ apple varieties plus pears, Asian pears, cherries, and stone fruit, farm stand, and the Hood River Valley's largest U-Pick.

orchardjapanese-americanheirloommulti-generational

Kleather's Pumpkin Patch

in directory

Kleather's Pumpkin Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Knowland Family Farm

in directory

Knowland Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Kokopelli Farm Market

📍 952 I 70, Palisade, CO, 81526

in directory

Kokopelli Farm Market — a family-operated USDA Certified Organic orchard and farm market in Palisade, Colorado, established 1979. Grows organic produce without synthetic inputs (signature Palisade peaches + diversified vegetables) and handcrafts value-added items including fried pies from on-orchard fruit.

orchardusda-organicfamily-operatedpalisade-peach

Kopp's Krops

📍 Beloit, WI, 53511

in directory

Kopp's Krops — a Certified Naturally Grown produce and flowers operation in Beloit, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Kordick Family Farm

📍 Westfield, NC, 27053

in directory

Kordick Family Farm — a Certified Naturally Grown produce and flowers operation in Westfield, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Kospia Farms

📍 2288 State Street, Alburtis, PA, 18011

in directory

Retail plant nursery in Alburtis growing organic herbs and vegetables alongside trees, shrubs, and perennials — operating in the Schuylkill Valley since 1955.

nurseryorganicsince-1955

Kozzinsky Farm (Wholesale)

in directory

Kozzinsky Farm (Wholesale) — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Krause House Farms

📍 Paron, AR, 72122

in directory

Krause House Farms — a Certified Naturally Grown produce and flowers operation in Paron, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Kreider Farms

📍 286 Doe Run Road

in directory

Kreider Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedhemp-farm

KRISHNA PLANTATIONS PVT LTD

📍 Goa, India

in directory

KRISHNA PLANTATIONS PVT LTD — an NPOP-certified organic operator in Goa, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiagoa

Kritz Farms

📍 Cedar Grove, 53013

in directory

Kritz Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Krueger Vegetables

📍 28572 West Belvidere Road, Lakemoor, IL, 60051

in directory

Krueger Vegetables — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Krumwiede Farms LLC

in directory

Krumwiede Farms LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Krupski Farms

📍 38030 Main Road, Peconic, NY, 11958

in directory

Krupski Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Kuilima Farm

📍 57-146 Kamehameha Highway, Kahuku, HI, 96731-2156

in directory

Kuilima Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

KUMAON EXPORTS PRIVATE LIMITED (UNIT: HERBAL CREATIONS)

📍 Uttarakhand, India

in directory

KUMAON EXPORTS PRIVATE LIMITED (UNIT: HERBAL CREATIONS) — an NPOP-certified organic operator in Uttarakhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttarakhand

Kumu Farms

in directory

Kumu Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Kurtzhal's Farms

in directory

Kurtzhal's Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

KV NATURAL INGREDIENTS PRIVATE LIMITED

📍 Telangana, India

in directory

KV NATURAL INGREDIENTS PRIVATE LIMITED — an NPOP-certified organic operator in Telangana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatelangana

KVS AGRO GENERAL TRADING PRIVATE LIMITED

in directory

KVS AGRO GENERAL TRADING PRIVATE LIMITED — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

L & E’s Country Market

📍 807 NC-126, Morganton, NC, 28655

in directory

L & E’s Country Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

La Casa de las Frutas

📍 3104 North Front Street, Philadelphia, PA, 19133

in directory

La Casa de las Frutas — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

La Conner Gardens

in directory

La Conner Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

La Grange Family Farm

📍 5498 Valley Pike, 22655

in directory

La Grange Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

La Pasta

in directory

La Pasta — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Ladybug Farm Produce

in directory

Ladybug Farm Produce — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Lake Michigan Lavender

📍 Holland, MI, 49424

in directory

Lake Michigan Lavender — a Certified Naturally Grown produce and flowers operation in Holland, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lakeland Feed and Supply

📍 201 Railroad Avenue, Alberton, MT, 59820

in directory

Lakeland Feed and Supply — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lakeview Pecans

📍 15370 Old Smithfield Road, Bailey, NC, 27807

in directory

Lakeview Pecans — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

LALPURA JAIVIK UTPADAK SAMITI 18 STB

📍 Rajasthan, India

in directory

LALPURA JAIVIK UTPADAK SAMITI 18 STB — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Land Of Giants Pumpkin Farm

in directory

Land Of Giants Pumpkin Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Langwater Farm Farmstand

in directory

Langwater Farm Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Lansing's Farm

📍 204 Lisha Kill Road, Schenectady, NY, 12309

in directory

Lansing's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Larriland Farm

📍 2415 Woodbine Road, Woodbine, MD, 21797

in directory

Larriland Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

LarryVille Gardens LLC

📍 Burlington, WI, 53105

in directory

LarryVille Gardens LLC — a Certified Naturally Grown produce and flowers operation in Burlington, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Laskein Organic Producers Cooperative Society Ltd (Group I)

📍 Meghalaya, India

in directory

Laskein Organic Producers Cooperative Society Ltd (Group I) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Laskein Organic Producers Cooperative Society Ltd (Group II)

📍 Meghalaya, India

in directory

Laskein Organic Producers Cooperative Society Ltd (Group II) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Last Minute Ranch

in directory

Last Minute Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Last Stand Farm

📍 5654 South Allen Road, Cochranton, PA

in directory

Last Stand Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedgrain-farm

Latham Farmstand

📍 Main Road, Orient, 11957

in directory

Latham Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Laurel Locks Farm

📍 1040 West Schuylkill Road, Pottstown, PA, 19465

in directory

Laurel Locks Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

LaValley Farms

in directory

LaValley Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Lavender Hill Farm

📍 Boyne City, MI, 49712

in directory

Lavender Hill Farm — a Certified Naturally Grown produce and flowers operation in Boyne City, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lavender Ridge Herb Farm

📍 Natrona Heights, PA, 15065

in directory

Lavender Ridge Herb Farm — a Certified Naturally Grown produce and flowers operation in Natrona Heights, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

LavenderBlu Farms, LLC

📍 Winterville, GA, 30683

in directory

LavenderBlu Farms, LLC — a Certified Naturally Grown produce and flowers operation in Winterville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lavigne's Strawberry Farm

in directory

Lavigne's Strawberry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Lawson Peach Shed

📍 8545 Valdosta Highway, Morven, GA, 31638

in directory

Lawson Peach Shed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

LB's Farm

📍 Cameron, NC, 28326

in directory

LB's Farm — a Certified Naturally Grown produce and flowers operation in Cameron, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Leach Farm

in directory

Leach Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Ledgewood Farm

in directory

Ledgewood Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lee Farms

📍 Kent, NY, 14477

in directory

Lee Farms — a Certified Naturally Grown livestock operation in Kent, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Lee Farms

in directory

Lee Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lee's Produce & Garden Center

📍 401 West Main Street, Clayton, NC, 27520

in directory

Lee's Produce & Garden Center — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Leffler Family Farm

📍 37414 County Road 29, Eaton, CO, 80615

in directory

Leffler Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Legacy Acres

📍 2224 Main Street, Narvon, PA, 17555

in directory

A family farm and farm-stand at 2224 Main Street in Narvon, PA — Lancaster County, eastern Pennsylvania farm country. Sells farm-fresh vegetables, dairy products, and flowers directly from the farm. Phone: (610) 286-5880. Lancaster County is one of the densest agricultural-Amish-and-Mennonite small-farm regions in the eastern US — Legacy Acres is one stop in that broader landscape.

farm-standvegetabledairyflowers

Lehman's Roadside Market

📍 1918 Powder Mill Road, York, 17402

in directory

Lehman's Roadside Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lesher Poultry Farm

in directory

Lesher Poultry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Lettuce Grow Your Garden

📍 Woodinville, WA, 98077

in directory

Lettuce Grow Your Garden — a Certified Naturally Grown produce and flowers operation in Woodinville, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Levering Orchard

📍 2294 Orchard Gap Road, Ararat, VA, 24053

in directory

Levering Orchard is a fifth-generation family orchard in Ararat, VA, founded in 1908 and known as 'the largest and most beautiful cherry orchard in the South' — 33 acres of cherries across 59 varieties, plus apples, pears, and peaches. Pick-your-own model with an on-site outdoor theatre; named to Tasting Table's 15 Best Cherry Orchards in America.

orchardcherry-orchardheirloommulti-generational

Lewin Farms

📍 812 Sound Avenue, Calverton, NY, 11933

in directory

Lewin Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Lewis' Orchards

in directory

Lewis' Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Lewis's Orchard

in directory

Lewis's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Lexington Community Farm

📍 52 Lowell Street, Lexington, MA

in directory

Lexington Community Farm (LexFarm) is a 5-acre year-round organic vegetable farm in Lexington, MA, run as a nonprofit. Farm store, CSA, and child-education programs (ages 6mo–12y), with explicit food-access infrastructure: SNAP matching, food-pantry donations, and need-based scholarships.

vegetable-farmorganicnonprofitfood-access

Libby & Sons u-pick

in directory

Libby & Sons u-pick — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Liberty Acres Farm

📍 Pocono Mountains, Pennsylvania

in directory

A small, sustainable, diversified Pocono Mountains farm raising chickens, pigs, turkeys, and lamb using rotational grazing methods explicitly modeled after Joel Salatin's Polyface Farm in Virginia. The Polyface model — rotational grazing through tightly-managed paddock systems, multi-species symbiosis (the cattle-chicken-pig sequence), and direct-to-consumer sales — adapted for Pocono conditions. One of the bioregion's clearest demonstrations that the model travels: the practices Polyface developed in Virginia's milder climate work on Pocono Plateau ground.

rotational-grazingpolyface-methodpasture-raisedmulti-species

Liberty Farms

📍 453A 4th Street, Ghent, NY

in directory

Liberty Farms — a 600+-acre NOFA-NY Certified Organic farm in Ghent, New York, running regenerative agriculture across vegetables, poultry, eggs, and pork. Meats are Animal Welfare Approved; the operation is explicit about pairing organic crops with welfare-certified livestock in service of healthy communities in the Hudson Valley.

certified-organicnofa-nyregenerativeanimal-welfare-approved

Licking Creek Bend Farm

📍 Needmore, PA, 17238

in directory

Licking Creek Bend Farm — a Certified Naturally Grown produce and flowers operation in Needmore, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

LiCrucian Legacy Farm

📍 Framingham, MA, 01701

in directory

LiCrucian Legacy Farm — a Certified Naturally Grown produce and flowers operation in Framingham, MA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Liepold Pond Farm

📍 Pawcatuck, CT, 06379

in directory

Liepold Pond Farm — a Certified Naturally Grown produce and flowers operation in Pawcatuck, CT. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Life Farms Clearwater

in directory

Life Farms Clearwater — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Life Under the Oaks Lavender Farm

in directory

Life Under the Oaks Lavender Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

Lightwell Lavender Farm

📍 2150 Carroll Road, Traverse City, MI, 49686

in directory

Lightwell Lavender Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

Lila's Loaves

in directory

Lila's Loaves — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lilac City Harvest

📍 13902 East 32nd Avenue, Spokane Valley, WA, 99037

in directory

Half-acre vegetable operation in Spokane Valley using organic growing practices and organic seed where available. Accepts EBT/SNAP at the farm and runs a pre-season CSA buy-in ($100–$500) that customers spend down across the June–October season.

vegetable-farmorganic-practicecsaebt-snap

Lillians Market

in directory

Lillians Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lilliputopia

📍 301 North 10th Street, Monroe, OR, 97456

in directory

Lilliputopia is a small dry-farmed eco-farm in Monroe, OR (Willamette Valley), run by Thorin Nielson and Eliza Mason. Field vegetables grown without irrigation, pesticides, or chemical fertilizers; rotational grazing; weekend farm store (April–October) selling organic produce + work from 35+ local artisans. Active partnerships with Oregon State University and the Dry Farming Institute for regenerative-ag education.

vegetable-farmdry-farmingregenerativeno-pesticides

Lilly and zoes lemonade stand / farm store

in directory

Lilly and zoes lemonade stand / farm store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lily Hill Farm

📍 Lawton, MI, 49065

in directory

Lily Hill Farm — a Certified Naturally Grown produce and flowers operation in Lawton, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lindley Organic Farm

📍 3452 Farm-to-Market Road 49, 75773

in directory

Lindley Organic Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Litsinger Enterprises, LLC

📍 Boaz, KY, 42027

in directory

Litsinger Enterprises, LLC — a Certified Naturally Grown apiary operation in Boaz, KY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Little Acres Farm Market

in directory

Little Acres Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Little Brown House Herbary

📍 Boring, OR, 97009

in directory

Little Brown House Herbary — a Certified Naturally Grown produce and flowers operation in Boring, OR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Little Duck Farms

📍 66 Rice Lane, Ray City, GA, 31645

in directory

Little Duck Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Little Farm Fresh

📍 Markdale, ON, N0C 1H0

in directory

Little Farm Fresh — a Certified Naturally Grown produce and flowers operation in Markdale, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Little Hill Farm

📍 8638 Wikaryasz Road, Maple Ridge Township, MI, 49707

in directory

Little Hill Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Little Miss Sweet Pea's

in directory

Little Miss Sweet Pea's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Little Riddle LLC

📍 891 South Sandy Hook Road, Shiloh, NC, 27974

in directory

Little Riddle LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Little Toccoa Creek Farm

📍 Toccoa, GA, 30577

in directory

Little Toccoa Creek Farm — a Certified Naturally Grown produce and flowers operation in Toccoa, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Little Wren Farm Apiary

📍 Northampton, MA, 01060

in directory

Little Wren Farm Apiary — a Certified Naturally Grown apiary operation in Northampton, MA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Living Earth Systems

in directory

Living Earth Systems — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Living Faith Acres

📍 121 Crater Lane, Spring Mills, PA, 16875

in directory

Living Faith Acres — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Living Hope Farm

📍 461 Indian Creek Road, Harleysville, PA, 19438

in directory

A 501(c)(3) nonprofit working farm at 461 Indian Creek Road in Harleysville, PA — Montgomery County, Schuylkill Valley region. Certified Naturally Grown (CNG, a peer-reviewed alternative to USDA organic). Runs a 260+ member CSA (24-week summer season + November-February Winter CSA) with choose-your-own harvest boxes. Operates at the Lansdale Farmers Market every Saturday May-September and runs an indoor public market May-February. Active food-justice arm: weekly fresh produce donations to 23 families in the Souderton Area School District, The Bridge of Hope, regional cancer families, and food pantries across Montgomery and Bucks Counties.

nonprofitcertified-naturally-growncsawinter-csa

living landscapes

📍 Benson, VT, 05743

in directory

living landscapes — a Certified Naturally Grown produce and flowers operation in Benson, VT. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Living Pastures Farm

📍 9577 Cliff Mills Road

in directory

Living Pastures Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Local Boys

in directory

Local Boys — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Local Roots Farm

in directory

Local Roots Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Local Roots Farm LLC

📍 Farmersburg, IN, 47850

in directory

Local Roots Farm LLC — a Certified Naturally Grown produce and flowers operation in Farmersburg, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lockard's Produce, LLC

📍 Glimp, TN, 38063

in directory

Lockard's Produce, LLC — a Certified Naturally Grown produce and flowers operation in Glimp, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lockewood Acres

📍 Vacaville, CA, 95688

in directory

Lockewood Acres — a Certified Naturally Grown produce and flowers operation in Vacaville, CA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lockwood Farm Store

📍 351 Sambo Lambert Road

in directory

Lockwood Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Locust Woods Farm

📍 420 Dawson Hill Road, Spencer, NY, 14883

in directory

A blueberry-and-fruit farm at 420 Dawson Hill Road in Spencer, NY (Tioga County, Finger Lakes region) — daily fresh-picked and U-pick blueberries plus other small fruit, with on-farm value-added production (jams, jellies, syrups, and fruit wines). 'Top-of-the-mountain' siting on the southern Finger Lakes uplands.

blueberriessmall-fruitu-pickjam

Log Cabin Farm

📍 Apple Creek, OH, 44606

in directory

Log Cabin Farm — a Certified Naturally Grown produce and flowers operation in Apple Creek, OH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lohr's Orchard Farm Market

📍 3301 Churchville Road, Aberdeen, MD, 21001

in directory

Family-owned Harford County, Maryland orchard and farm market operating since 1928. Grows apples and seasonal produce, presses fresh cider in season, bakes pies on-site, and runs pick-your-own alongside a regular farmers-market route across the Chesapeake Tidewater.

orchardfamily-ownedsince-1928fresh-cider

Lone Oak Farms

📍 Bellaire, OH, 43906

in directory

Lone Oak Farms — a Certified Naturally Grown produce and flowers operation in Bellaire, OH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Long Acre Farms

📍 1342 Eddy Road, Macedon, 14502

in directory

Long Acre Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Long Family Orchard Farm & Cider Mill

📍 1540 East Commerce Road, 48382

in directory

Long Family Orchard Farm & Cider Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Long Wind Farm

📍 82 Wilson Road, Thetford, VT, 05043

in directory

Long Wind Farm is a 41-year-old certified-organic operation in East Thetford, VT, growing organic tomatoes year-round in two glass greenhouses on real soil — not hydroponics. Northeast direct sales, plus active advocacy work to protect organic standards from soilless-grown loopholes.

vegetable-farmcertified-organicsoil-growngreenhouse

Longfellow Farms

📍 9901 MN 23

in directory

Longfellow Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Longpoint Farm

📍 Washburn, MO, 65772

in directory

Longpoint Farm — a Certified Naturally Grown produce and flowers operation in Washburn, MO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lookout Farm

in directory

Lookout Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lorence's Berry Farm

📍 28556 Foliage Avenue, Northfield, MN, 55057

in directory

Lorence's Berry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Lost Sheep Ranch

📍 4019 Enola Road, Newville, PA, 17241

in directory

A south-central Pennsylvania ranch in Newville producing 100% grass-fed lamb and pasture-raised chicken eggs. Self-described as 'a sustainable, all natural ranching operation' — sheep on grass without grain supplementation, hens on pasture. Sells directly from the ranch to the eater, and offers a 10% discount for payment in Bitcoin.

livestock-farmgrass-fedpasture-raiseddirect-from-farm

Lost Weekend Farms

📍 Madison, TN, 37115

in directory

Lost Weekend Farms — a Certified Naturally Grown produce and flowers operation in Madison, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Loudounberry

📍 James Monroe Highway, Leesburg, VA, 20176

in directory

Loudounberry — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Love Bug Farm

📍 Upper Marlboro, MD, 20774

in directory

Love Bug Farm — a Certified Naturally Grown produce and flowers operation in Upper Marlboro, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Love Light Farm

📍 Wilsonville, AL, 35186

in directory

Love Light Farm — a Certified Naturally Grown produce and flowers operation in Wilsonville, AL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Love of the Land Farms

📍 Maysville, GA, 30558

in directory

Love of the Land Farms — a Certified Naturally Grown livestock operation in Maysville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Low Hill Garden

📍 Rockingham, VA, 22802

in directory

Low Hill Garden — a Certified Naturally Grown produce and flowers operation in Rockingham, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lower Level Concession Stand

in directory

Lower Level Concession Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lowry Farms

📍 2118 Lee Morris Road, 32565

in directory

Lowry Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

LS Farmstead

📍 77479 Dugan Lane, Cottage Grove, OR, 97424

in directory

LS Farmstead — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Luck and Moody Peaches

📍 13891 Highway 122, Barney, GA, 31625

in directory

Luck and Moody Peaches — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Luckie Farms

in directory

Luckie Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Lucky 13 Farm, LLC

📍 Winchester, NH, 03470

in directory

Lucky 13 Farm, LLC — a Certified Naturally Grown produce and flowers operation in Winchester, NH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lucky Fields LLC.

📍 Chester, VT, 05143

in directory

Lucky Fields LLC. — a Certified Naturally Grown livestock operation in Chester, VT. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Lum Farm

📍 1071 Crow Valley Road, Eastsound, WA, 98245

in directory

An Orcas Island, Washington full-service farm operating on the Coffelt Farm Preserve — a permanent agricultural conservation easement. The operation produces artisan meats (beef, goat, lamb, pork), cheese, eggs, dairy, produce, hay, garden plants, and wool. Runs a farmstand on-site with Thursday-through-Saturday hours and self-serve plus online ordering for daily availability.

livestock-farmdairymulti-productconservation-easement

Lumber

in directory

Lumber — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Luna Brothers Fruit Plaza

in directory

Luna Brothers Fruit Plaza — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Luna de Sonora Farm

📍 Tucson, AZ, 85735

in directory

Luna de Sonora Farm — a Certified Naturally Grown produce and flowers operation in Tucson, AZ. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Lynd Fruit Farm Apple Picking

in directory

Lynd Fruit Farm Apple Picking — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Lyons Farm Market

in directory

Lyons Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

M-R Chile Sales

📍 323 West Canal Road, Hatch, NM, 87937

in directory

M-R Chile Sales — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

M/S Jas Kumar Farm

📍 Haryana, India

in directory

M/S Jas Kumar Farm — an NPOP-certified organic operator in Haryana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiaharyana

M/S Shivalik Natural Products

📍 Uttarakhand, India

in directory

M/S Shivalik Natural Products — an NPOP-certified organic operator in Uttarakhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttarakhand

M/S.SREEDHAREEYAM FARMHERBS INDIA PVT LTD

📍 Kerala, India

in directory

M/S.SREEDHAREEYAM FARMHERBS INDIA PVT LTD — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

MAA AMBEY PRODUCER GROUP

📍 Punjab, India

in directory

MAA AMBEY PRODUCER GROUP — an NPOP-certified organic operator in Punjab, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiapunjab

Machado Orchards

📍 221 Robin ln.

in directory

Machado Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Mack Aaron's Apple House

📍 8955 GA 52, Ellijay, GA, 30536

in directory

Mack Aaron's Apple House — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Mad Radish Farm Share

📍 1991 George Street, 17315

in directory

Mad Radish Farm Share — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

MADHURI PRAJAPAT FARM

📍 Rajasthan, India

in directory

MADHURI PRAJAPAT FARM — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Madukkakunnu Estate

📍 Kerala, India

in directory

Madukkakunnu Estate — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Maegog Market

in directory

Maegog Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Magicland Farms

📍 4380 South Gordon Avenue, Fremont, MI, 49412

in directory

Magicland Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Magnolia Honey Co

📍 Magnolia, DE, 19962

in directory

Magnolia Honey Co — a Certified Naturally Grown apiary operation in Magnolia, DE. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Malacari's

in directory

Malacari's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Malara Gardens

in directory

Malara Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Malench Farm Market

in directory

Malench Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Maljons Farm

📍 123 NY 41, Windsor, NY, 13865

in directory

Maljons Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Malley Farms Specialty Shop

📍 54 South Seminary Street

in directory

Malley Farms Specialty Shop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Maltby Farm Fresh Produce

📍 19523 Broadway Avenue, Snohomish, WA, 98296

in directory

Maltby Farm Fresh Produce — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Mama Hen's Farmstand

in directory

Mama Hen's Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Mama Tee's Farmstead

📍 16751 Southwest Willamina Creek Road, Willamina, OR, 97396

in directory

Willamette Valley diversified homestead growing produce and raising pasture-based poultry and meat using organic practices (uncertified). Sells via CSA, farmers market, and on-farm channels.

vegetable-farmpoultry-farmorganic-practicescsa

Manaserro Farms

📍 Rose Drive, Brea, CA, 92823

in directory

Manaserro Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Manassero Farms

📍 18921 East 17th Street, Tustin, CA 92705 (plus flagship market at 33 Irvine Valley, Irvine, CA 92618)

in directory

Multi-generational Orange County family farm — operating 100+ years across multiple generations of the Manassero family. Flagship farm market and event space at 33 Irvine Valley, Irvine, CA. Fresh produce + on-site baked goods + u-pick experience + private events. Separate Christmas tree farm operation. The directory's senior heritage-farm anchor in the Los Angeles Basin's Orange County reach.

family-farmmulti-generationalorange-countyirvine

Manassero Farms Market & Christmas Tree Farms

📍 5840 Walnut Avenue, Irvine, CA, 92618

in directory

Manassero Farms Market & Christmas Tree Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

Manda chijol-I Organic Producers Cooperative Society Ltd

📍 Meghalaya, India

in directory

Manda chijol-I Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Manda chijol-II Organic Producers Cooperative Society Ltd

📍 Meghalaya, India

in directory

Manda chijol-II Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Mandala Farm Store

in directory

Mandala Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

MANDHA JAIVIK UTPADAK SAMITI 25 LGW B

📍 Rajasthan, India

in directory

MANDHA JAIVIK UTPADAK SAMITI 25 LGW B — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Mandile Fruit Co

📍 260 Fremont Avenue North, Minneapolis, MN, 55405

in directory

Mandile Fruit Co — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mangini's Farm

📍 2592 Pleasant Hill Road, Pleasant Hill, CA, 94523

in directory

Mangini's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

MANKULAM NEW ICS (SHM PROJECT)

📍 Kerala, India

in directory

MANKULAM NEW ICS (SHM PROJECT) — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Mann's Orchards

📍 27 Pleasant Valley Street, Methuen, MA, 01844

in directory

Mann's Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Maple Grove Farm

📍 3424 Durham Road, Guilford, CT, 06437

in directory

Maple Grove Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Maple Wind Farm

📍 1149 East Main Street, Richmond, VT, 05477

in directory

Maple Wind Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

March Farms

📍 160 Munger Lane, Bethlehem, CT, 06751

in directory

Fourth-generation Connecticut family farm in Bethlehem with seasonal pick-your-own berries and fruit. Uses ladybug releases in greenhouses for aphid control — a stated integrated-pest-management practice.

berry-farmmulti-generationalfourth-generationipm

Marini Farm

📍 259 Linebrook Road, Ipswich, MA, 01938-1149

in directory

Marini Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Market & Cafe at Emery Farm

in directory

Market & Cafe at Emery Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Marlow Farms

📍 3695 Plum Point Road

in directory

Marlow Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Marshall's Produce - Tomatoes & Such (seasonal)

📍 95 Royce Webster Drive, Apex, NC, 27523

in directory

Marshall's Produce - Tomatoes & Such (seasonal) — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Martin's Farmstand

📍 11 Needham Road, Potsdam, NY, 13676

in directory

Martin's Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mast Candy Kitchen

in directory

Mast Candy Kitchen — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

MAULI SHENDRIY SHETI SANSTHA

📍 Maharashtra, India

in directory

MAULI SHENDRIY SHETI SANSTHA — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Mauro Farms Market & Bakery

📍 936 36th Lane, Pueblo, CO, 81006

in directory

Mauro Farms Market & Bakery — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedgrain-farm

Maximuck's Farm Market

📍 5793 Long Lane, Doylestown, PA, 18902

in directory

Maximuck's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

McAbee Feed & Supply

📍 71 McCloskey Road, Hollister, 95023-9388

in directory

McAbee Feed & Supply — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

McArdle's Holiday Farm

in directory

McArdle's Holiday Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

McChesney Farm Market

in directory

McChesney Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

McCollum Orchards LLC

📍 Lockport, NY, 14094

in directory

McCollum Orchards LLC — a Certified Naturally Grown produce and flowers operation in Lockport, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

McCraw's Strawberry Ranch

📍 2385 Rossview Road, Clarksvilla, TN, 37043

in directory

McCraw's Strawberry Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

McDougal Orchards

📍 201 Hanson Ridge Road, Springvale, ME, 04083

in directory

McDougal Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

McDowell Farms

📍 3731 Highway 11 West, Chesnee, SC, 29323

in directory

McDowell Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

McEnroe Organic Farm Market

1,000 ac

📍 5409 Route 22, Millerton, NY, 12546

in directory

One of New York State's oldest and most diverse certified-organic farms — over 1,000 acres of fields, pastures, and greenhouses in Millerton, NY (Mid-Hudson Valley). Founded 1952; NOFA-NY certified organic for over 25 years. Produces compost and soils (a major regional business in its own right), organic and naturally-raised meats, greenhouse tomatoes, seasonal vegetables, and nursery transplants. Operates an educational garden with tours and public events. The on-site Farm Market & Eatery is currently closed; reopening teased per recent Millerton News coverage.

certified-organicnofacompostmeats

McGee’s Christmas Tree Farm

📍 3131 Carson Road, Placerville, CA

in directory

McGee’s Christmas Tree Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

McGlasson Farms

📍 5832 River Road

in directory

McGlasson Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

McLawland Farms

📍 8632 Reedy Creek Greenway, Charlotte, NC, 28215

in directory

McLawland Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

McLawland Farms LLC

📍 Charlotte, NC, 28215

in directory

McLawland Farms LLC — a Certified Naturally Grown produce and flowers operation in Charlotte, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

McLeod Farms

in directory

McLeod Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

McMullan Family Farm

📍 Hartwell, GA, 30643

in directory

McMullan Family Farm — a Certified Naturally Grown produce and flowers operation in Hartwell, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

McNeal Orchards and Sugarbush

📍 7104 Brush Valley Road, Rebersburg, PA, 16872

in directory

McNeal Orchards and Sugarbush — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

McVay Family Homestead

in directory

McVay Family Homestead — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Meadow Ledge Farm

📍 612 Route 129, Loudon, NH

in directory

Meadow Ledge Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Meadowstone Farm Shop

in directory

Meadowstone Farm Shop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Meckley’s Flavor Fruit Farm

📍 11025 S South Jackson Road, 49233

in directory

Meckley’s Flavor Fruit Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Medlyn's Farm Market

in directory

Medlyn's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

MEG ICS ORGANIC TEA PROJECT

📍 Meghalaya, India

in directory

MEG ICS ORGANIC TEA PROJECT — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Meldrum Fresh Market Stand

in directory

Meldrum Fresh Market Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Melick's Town Farm

📍 472 County Road 513, Califon, NJ, 07830

in directory

Melick's Town Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

MELLI KHECHUPERI GROWER GROUP (SBOR13SKWSMK)

📍 Sikkim, India

in directory

MELLI KHECHUPERI GROWER GROUP (SBOR13SKWSMK) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

Melon Man

in directory

Melon Man — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Meños Farms

in directory

Meños Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mercier Farms

📍 210 State Highway 32, 12561

in directory

Mercier Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Mesa Farm Market

in directory

Mesa Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Mesman Farm Store

📍 La Conner, WA (Skagit Valley)

in directory

Certified-organic family dairy farm outside La Conner, Washington, raising USDA-inspected pasture beef, lamb, and heritage pork in the Skagit Valley.

livestock-farmcertified-organicpasture-raisedskagit-valley

Metro Microgreens

📍 Rockville, MD, 20850

in directory

Metro Microgreens — a Certified Naturally Grown produce and flowers operation in Rockville, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Meyer's Farm

in directory

Meyer's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Meyer's Farm Market

in directory

Meyer's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

MHM Ranch

📍 1443 East Bertram Road, Cedar Rapids, IA, 52403

in directory

MHM Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

MicroGreens Farm LLC

📍 1220 Tangelo Terrace, Delray Beach, FL, 33444

in directory

MicroGreens Farm LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Middle Intervale Farm

📍 758 Intervale Road, Bethel, ME, 04217

in directory

Middle Intervale Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Middle Way Farm

📍 Grinnell, IA, 50112

in directory

Middle Way Farm — a Certified Naturally Grown produce and flowers operation in Grinnell, IA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Midwest Maple

in directory

Midwest Maple — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Miel del Sol, LLC

📍 Farmington, NM, 87401

in directory

Miel del Sol, LLC — a Certified Naturally Grown apiary operation in Farmington, NM. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Migliorelli Farm

📍 5150 State Route 28, Mount Tremper, NY, 12457

in directory

Migliorelli Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Mike's Produce and Seafood

in directory

Mike's Produce and Seafood — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Mikes Western Wear

📍 22929 Southeast 436th Street, Enumclaw, WA, 98022

in directory

Mikes Western Wear — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mile Creek Farm Market

📍 3020 Walhalla Highway, Six Mile, SC, 29682

in directory

Mile Creek Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mile Level Farm Market & Greenhouses

📍 9571 Lincoln Highway, Bedford, PA

in directory

Mile Level Farm Market & Greenhouses — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Miles of Maple

in directory

Miles of Maple — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Milk House Farm Market

📍 1118 Slack Road, Newtown, PA

in directory

Milk House Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Milk Pail

📍 1346 Montauk Highway, Water Mill, 11976

in directory

Milk Pail — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mill Creek Farms

in directory

Mill Creek Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Milleflora Farm

📍 Cazadero, CA, 95421

in directory

Milleflora Farm — a Certified Naturally Grown produce and flowers operation in Cazadero, CA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Miller Valley CSA Farm

📍 Kennedy, NY, 14747

in directory

Miller Valley CSA Farm — a Certified Naturally Grown produce and flowers operation in Kennedy, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Milo Market

in directory

Milo Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mindful Mushrooms

📍 Oregon City, OR, 97045

in directory

Mindful Mushrooms — a Certified Naturally Grown mushrooms operation in Oregon City, OR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Mindfull Mycology LLC

📍 Dawsonville, GA, 30534

in directory

Mindfull Mycology LLC — a Certified Naturally Grown mushrooms operation in Dawsonville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Mini Barn Market

📍 17111 Whirlwind Lane, Ramona, CA, 92065-7018

in directory

Mini Barn Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mini Super

📍 59 Spruce Street, Columbus, OH, 43215

in directory

Mini Super — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Minnesota Harvest Craft Cider Bar & Orchard

📍 8251 Old Highway 169, Jordan, MN, 55352

in directory

Minnesota Harvest Craft Cider Bar & Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Minto Island Growers

in directory

Minto Island Growers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mission of Mary Roadside Market

📍 Xenia Avenue, Dayton, OH, 45410

in directory

Mission of Mary Roadside Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Misty Brook Farm Shop

📍 156 Bog Road, Albion, ME, 04910

in directory

A certified-organic family farm and on-farm retail store in Albion, Maine — raw cow and sheep milk, grass-fed beef, veal, and lamb, pastured pork, soy-free eggs, and organic grains; supplemented by complementary products from neighboring farms. Self-service farm shop open every day of the year, dawn to dusk. Rotational-grazing management and an open working-farm visitor culture.

certified-organicraw-dairygrass-fedpastured-pork

Misty Valley Farm

in directory

Misty Valley Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Misty Valley Farms

in directory

Misty Valley Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mitchell Farm

in directory

Mitchell Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Mobile Seafood Market - BP West End

📍 1450 Donnelly Avenue Southwest, Atlanta, GA, 30310-2543

in directory

Mobile Seafood Market - BP West End — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Modesto Feed

in directory

Modesto Feed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Molesky Greenhouses

in directory

Molesky Greenhouses — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Momma D's Kitchen

📍 405 Seward Avenue Northwest, Grand Rapids, MI, 49504-2907

in directory

Momma D's Kitchen — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Monahan's Farmstand

in directory

Monahan's Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Monroe's Peach Ranch

📍 US 287, Hedley, TX, 79237

in directory

Monroe's Peach Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Monti Farms & Deli

📍 194 Worcester Road, Princeton, 01541

in directory

Monti Farms & Deli — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Montpelier Farms Farm Shop

in directory

Montpelier Farms Farm Shop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mood's Farm Market

in directory

Mood's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

MOOLAKARA WAYANAD SPICES PRIVATE LIMITED

📍 Kerala, India

in directory

MOOLAKARA WAYANAD SPICES PRIVATE LIMITED — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Moon Market & Music

in directory

Moon Market & Music — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Moonchild blooms flower farm

📍 Greeneville, TN, 37745

in directory

Moonchild blooms flower farm — a Certified Naturally Grown produce and flowers operation in Greeneville, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Moonrise Meadows Farm

📍 Maple Falls, WA, 98266

in directory

Moonrise Meadows Farm — a Certified Naturally Grown produce and flowers operation in Maple Falls, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Morgan's Farm Market

📍 3821 Cory Corners Road, Marion, NY, 14505

in directory

Morgan's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Morning Glory Farm

📍 120 Meshacket Road

in directory

Morning Glory Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Morning Glory Farm & Espresso

📍 19540 Highway 126, Walton, OR, 97490

in directory

Morning Glory Farm & Espresso — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Morningfield Farm

📍 542 Greenwich Road

in directory

Morningfield Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Morris Farm Market

📍 3784 Caratoke Highway, Barco, NC, 27917

in directory

Morris Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Morris Orchard

in directory

Morris Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Morro Creek Ranch

📍 1800 Highway 41 West, CA

in directory

Morro Creek Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Mossy Glen Farm

📍 260 Lennon Road, Carroll, NH, 03598

in directory

Small New Hampshire farm raising pigs regeneratively and meat chickens on fresh grass daily. Member of the Free State Food Network; sells pork shares, laying-hen eggs, meat birds, and crafted goods.

livestock-farmregenerativepasture-raisedpork-share

Mother Farmer

📍 Ewen, MI, 49925

in directory

Mother Farmer — a Certified Naturally Grown produce and flowers operation in Ewen, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Mott Farms

in directory

Mott Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Moulton Farm

in directory

Moulton Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mount Olive Farms

📍 Gravette, AR, 72736

in directory

Mount Olive Farms — a Certified Naturally Grown produce and flowers operation in Gravette, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Mount Riverview Farm

in directory

Mount Riverview Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mountain Air Farm, LLC

📍 Independence, VA, 24348

in directory

Mountain Air Farm, LLC — a Certified Naturally Grown produce and flowers operation in Independence, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Mountain Gap Market

📍 119 John Singleton Mosby Highway, Paris, VA, 20130-3120

in directory

Mountain Gap Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mountain Harvest Farm

📍 Morgantown, WV, 26508

in directory

Mountain Harvest Farm — a Certified Naturally Grown produce and flowers operation in Morgantown, WV. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Mountain Laural Farm

in directory

Mountain Laural Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mountain Medicine Farm

📍 Etowah, TN, 37331

in directory

Mountain Medicine Farm — a Certified Naturally Grown produce and flowers operation in Etowah, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Mountain Valley Orchard

in directory

Mountain Valley Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Mousam Valley Apiary Farmstand

in directory

Mousam Valley Apiary Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

MTC AGRI PRIVATE LIMITED

in directory

MTC AGRI PRIVATE LIMITED — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

MUDAR INDIA EXPORTS

📍 Madhya Pradesh, India

in directory

MUDAR INDIA EXPORTS — an NPOP-certified organic operator in Madhya Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamadhya-pradesh

MUDAR INDIA EXPORTS

in directory

MUDAR INDIA EXPORTS — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Mudge Farms

in directory

Mudge Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mullett Meadows Farm

📍 3894 North M-33 Highway, Cheboygan

in directory

Mullett Meadows Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Munsell Farms

📍 6850 West Mason Road, Fowlerville, MI, 48836

in directory

Munsell Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Murray Family Farm

in directory

Murray Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Mushrooms Naturally

📍 1417 Hoff Industrial Drive, O'Fallon, MO, 63366

in directory

Mushrooms Naturally — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmushroom-farm

Musser's Market

📍 2282 State Route 66, Delmont, PA, 15626

in directory

Musser's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Musso Farms

📍 35779 Hillside Road, Pueblo, CO, 81006

in directory

Musso Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Muzzi Farms

📍 32843 Long Neck Road, Millsboro, DE, 19966

in directory

Muzzi Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

MX Morningstar Farm

📍 5956 Route 9H 23, Hudson, NY, 12534

in directory

MX Morningstar Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

My Mustard Seed, LLC

📍 St Leonard, MD, 20685

in directory

My Mustard Seed, LLC — a Certified Naturally Grown produce and flowers operation in St Leonard, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Mycoterra Farm

📍 75 Stillwater Road, South Deerfield, MA, 01373

in directory

A certified-organic mushroom farm in South Deerfield, Massachusetts, in the Pioneer Valley — growing shiitake, lion's mane, chestnut, pioppino, maitake, reishi, and multiple oyster varieties (Blue, Pink, Yellow, Black Pearl). Operates year-round indoor cultivation, packages on-site, and sells through an online shop, regional retail stores, an on-farm store with CSA enrollment, and farm pickup.

mushroom-farmcertified-organicindoor-cultivationcsa

Myrtle & Maude's

📍 10981 Elk Lake Road, Williamsburg, MI

in directory

Fourth-generation Northern Michigan cherry and apple farm (250 acres cherries, 50 acres apples), with first plantings in the 1940s. Won the 2026 National Cherry Festival's Very Cherry Promotion Award.

orchardcherryapplemulti-generational

Napiers Farm Supply

in directory

Napiers Farm Supply — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

NARAYAN DASS PRAJAPATI FARM

📍 Rajasthan, India

in directory

NARAYAN DASS PRAJAPATI FARM — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Nathan Hale Farm and Feed

📍 2050 Boston Turnpike, Coventry, CT, 06238

in directory

Nathan Hale Farm and Feed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

NATURAL FARMING SOCIETY MINDOLIYA

📍 Rajasthan, India

in directory

NATURAL FARMING SOCIETY MINDOLIYA — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

NATURAYUVA INDIA PRIVATE LIMITED

📍 Tamil Nadu, India

in directory

NATURAYUVA INDIA PRIVATE LIMITED — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Nature's Best Farmstand

in directory

Nature's Best Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Nature's Country Corner

📍 18033 Jack Tone Rd

in directory

Nature's Country Corner — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Nature's Sweet Secret Maple Syrup

📍 41 Tirrell Hill Road, Goffstown, NH

in directory

Nature's Sweet Secret Maple Syrup — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

NATURES BASKET LIMITED

📍 West Bengal, India

in directory

NATURES BASKET LIMITED — an NPOP-certified organic operator in West Bengal, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiawest-bengal

Nava Quality Foods Private Limited

📍 Andhra Pradesh, India

in directory

Nava Quality Foods Private Limited — an NPOP-certified organic operator in Andhra Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiaandhra-pradesh

NAXPAR PHARMA PVT. LTD.

📍 Himachal Pradesh, India

in directory

NAXPAR PHARMA PVT. LTD. — an NPOP-certified organic operator in Himachal Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiahimachal-pradesh

Naylor Roadside Market

📍 6116 NC-401 North, Fuquay Varina, NC, 27526

in directory

Naylor Roadside Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Nebzydoski Maple Farm

📍 Pleasant Mount, Pennsylvania (Wayne County)

in directory

A family-operated maple-syrup operation in Pleasant Mount, Wayne County, Pennsylvania, tapping approximately 3,200 sugar maples on the Pocono Plateau. One of several small-to-mid-scale Wayne County maple producers that together make the northern Poconos one of Pennsylvania's strongest maple-syrup-producing regions outside of the northern tier. The 3,200-tap scale is in the working range that supports commercial production while staying clearly family-scale rather than industrial.

maple-syrupfamily-farmpennsylvaniapoconos

Needmore Farms

📍 6502 Sunset Lake Road, Fuquay-Varina, NC, 27526

in directory

Needmore Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Neil Casey's Farm Market & Greenhouses

📍 6905 State Route 80, Tully, NY, 13159

in directory

Neil Casey's Farm Market & Greenhouses — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Neil's Bigleaf Maple Syrup

📍 2213 Hudson Road, Acme, WA, 97702

in directory

Neil's Bigleaf Maple Syrup — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Nelsons Blueberries

📍 410 North E Street, Bridgeton, NC, 28519

in directory

Nelsons Blueberries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

New Forest Farm

Mark Shepard's 106-acre working farm in Viola, Wisconsin (Vernon County, Driftless coulee country) — one of the most-visited and most-cited working examples of temperate perennial-polyculture agriculture in North America. Shepard bought the land in 1994 as degraded former corn-and-soy ground and started planting trees in 1995. Thirty years later the farm is a fully productive oak-savanna-modeled perennial system producing commercial volumes of chestnuts, hazelnuts, apples, raspberries, asparagus, grass-fed beef, pastured pork, and pastured poultry from a single integrated system now dominated by tree canopy. The farm is the practical proof-of-concept behind Shepard's *Restoration Agriculture* (2013) and the contemporary state of the art in chestnut and hazelnut breeding for staple-crop development — the program J. Russell Smith called for in 1929 finally executed at full farm scale. New Forest Farm sits inside the [[driftless-area|Driftless]] bioregion and is a substrate-builder reference operation for any Midwestern temperate perennial-agriculture work.

driftlessperennial-polyculturerestoration-agriculturechestnut

New Growth Project Farmstand

📍 Philadelphia, 19121

in directory

New Growth Project Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

New London Farm

📍 Forest, VA, 24551

in directory

New London Farm — a Certified Naturally Grown livestock operation in Forest, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

New North Farm

📍 Bemidji, MN, 56601

in directory

New North Farm — a Certified Naturally Grown produce and flowers operation in Bemidji, MN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

New Roots Market Garden

📍 Marshall, NC, 28753

in directory

New Roots Market Garden — a Certified Naturally Grown produce and flowers operation in Marshall, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

NEWGEN AGRO PROCESSORS PRIVATE LIMITED Managed By ITC LIMITED - AGRI BUSINESS DIVISION

📍 Tamil Nadu, India

in directory

NEWGEN AGRO PROCESSORS PRIVATE LIMITED Managed By ITC LIMITED - AGRI BUSINESS DIVISION — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Newton Farm Collective

📍 228 Spruceton Road, West Kill, 12492

in directory

Newton Farm Collective — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Nezinscot Farm Store

📍 284 Turner Center Road, Turner, ME, 04282

in directory

A working organic dairy in Turner, Maine, integrated with a year-round value-add cluster that's exceptional in scope: a cheesemaking facility, a butcher shop, a fiber studio, a farm-to-table cafe and bakery, a coffee shop, an herbal apothecary, and a grocery — all operating from the farm. Year-round CSA covers beef, pork, chicken, dairy, eggs, fruits, and vegetables. The on-farm bread program alone runs ten-plus varieties; the herb line runs teas, tinctures, infused oils, salves, and smudges.

dairycertified-organicmulti-producton-farm-cafe

NIDHIKET TECHNICAL SOLUTIONS PRIVATE LIMITED

📍 West Bengal, India

in directory

NIDHIKET TECHNICAL SOLUTIONS PRIVATE LIMITED — an NPOP-certified organic operator in West Bengal, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiawest-bengal

Nine Mile Farm

📍 Delmar, NY, 12054

in directory

Nine Mile Farm — a Certified Naturally Grown produce and flowers operation in Delmar, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Nishant Aromas Private Limited

📍 Uttarakhand, India

in directory

Nishant Aromas Private Limited — an NPOP-certified organic operator in Uttarakhand, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttarakhand

Nolt Farms

in directory

Nolt Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Norman's Farm Market

in directory

Norman's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Norman's Orchard

📍 2318 Butler Logan Road, Tarentum, PA, 15084

in directory

Norman's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

North 40 Farms

in directory

North 40 Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

North Chester Orchard

📍 460 North Chester Road, Chester, ME, 04457

in directory

North Chester Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

North Corner Farm

📍 13880 Butternut Road, Burton, OH, 44021

in directory

North Corner Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

North Haven Oyster

📍 Middle Road, North Haven, ME, 04853

in directory

North Haven Oyster — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

North Shore Farm

📍 1803 MT-82, Somers, MT, 59932

in directory

North Shore Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

North Star Orchard Farm Store

📍 3232 Limestone Road, Cochranville, PA, 19330

in directory

North Star Orchard Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

North Tisbury Farm

in directory

North Tisbury Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Northern Reach Maple

📍 458 Franklin School Road, Fort Kent, ME, 04743

in directory

Northern Reach Maple — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

NorthernBowlins

in directory

NorthernBowlins — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Norton Farmstand

in directory

Norton Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

NOURISH ORGANIC FOODS PRIVATE LIMITED

📍 Haryana, India

in directory

NOURISH ORGANIC FOODS PRIVATE LIMITED — an NPOP-certified organic operator in Haryana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiaharyana

Nourishing Acres

📍 Cedar Grove, NC, 27231

in directory

Nourishing Acres — a Certified Naturally Grown produce and flowers operation in Cedar Grove, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Nowaskie Melons

📍 3435 County Road 350 North, Patoka, IN

in directory

Nowaskie Melons — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Nunda Fruit Farm

in directory

Nunda Fruit Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

NuWaters Co-op.

in directory

NuWaters Co-op. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

O'Connor Acres

📍 Crystal Falls, MI, 49920

in directory

O'Connor Acres — a Certified Naturally Grown produce and flowers operation in Crystal Falls, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

O'Neill's Orchard

📍 4858 Route 20, La Fayette, NY, 13084

in directory

O'Neill's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Oak Meadows Farm

📍 6285 Noble Oaks Lane, Ferndale, WA, 98248-9494

in directory

Oak Meadows Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Oba Farms

📍 336 Miles Lane, Greenville, TX, 75401-1775

in directory

Oba Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

OCC Farmer’s Market

📍 2408 West Colorado Avenue, 80904

in directory

OCC Farmer’s Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Ocean Natural Farm

📍 Newport, NC, 28570

in directory

Ocean Natural Farm — a Certified Naturally Grown produce and flowers operation in Newport, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

OCGI Agro Processing Private Limited

📍 Madhya Pradesh, India

in directory

OCGI Agro Processing Private Limited — an NPOP-certified organic operator in Madhya Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamadhya-pradesh

Ochs Farm Market

📍 399 East County Road 40

in directory

Ochs Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Ochs Orchard Farm Market

in directory

Ochs Orchard Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

OCIMUM BOTANICALS EXTRACTS LLP

📍 Karnataka, India

in directory

OCIMUM BOTANICALS EXTRACTS LLP — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Ocock Farms

in directory

Ocock Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

OKHREY RIBDI GROWER GROUP (SBOR13SKWSOR)

📍 Sikkim, India

in directory

OKHREY RIBDI GROWER GROUP (SBOR13SKWSOR) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

Okra

in directory

Okra — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Olam Food Ingredients India Private Limited

in directory

Olam Food Ingredients India Private Limited — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

OLAM FOOD INGREDIENTS INDIA PRIVATE LIMITED

📍 Kerala, India

in directory

OLAM FOOD INGREDIENTS INDIA PRIVATE LIMITED — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Old Bear Honey

📍 35089 Glenn Highway, Glacier View Sutton, AK, 99674-8139

in directory

Old Bear Honey — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Old Cider Mill

📍 1287 Main Street, Glastonbury, CT, 06033

in directory

Old Cider Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Old Dial Road Farm

📍 Morganton, GA, 30560

in directory

Old Dial Road Farm — a Certified Naturally Grown produce and flowers operation in Morganton, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Old Red Barn

📍 5685 Kraus Road, Clarence, NY, 14031

in directory

Old Red Barn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Old School Farm at Dyberry Wilds

📍 303 Upper Woods Road, Honesdale, Pennsylvania 18431 (Dyberry Township, Wayne County)

in directory

A small farm and forest in Dyberry Township, Wayne County — Upper Pocono Mountains, just north of Honesdale — operating a CSA, hosting wood-fired pizza nights with farm- and locally-sourced ingredients, and offering camping and event hosting through Hipcamp. One of the bioregion's clearest examples of a small farm sustaining itself through the agritourism-and-CSA model: production, hospitality, and event revenue layered on the same ground. Address: 303 Upper Woods Road, Honesdale, PA 18431.

csaagritourismpizza-nightcamping

Old Town Farmstand

📍 2355 Main Bayview Road, Southold, NY, 11971

in directory

Old Town Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Olish Farms Country Market

in directory

Olish Farms Country Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Olive Oil Shops

📍 2722 Sudderth Drive, Ruidoso, NM, 88345

in directory

Olive Oil Shops — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Ollin Farms Farmstand

in directory

Ollin Farms Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Oma Herbal Teas

📍 Schwenksville, PA, 19473

in directory

Oma Herbal Teas — a Certified Naturally Grown produce and flowers operation in Schwenksville, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Open Book Farm

📍 6600 Roy Shafer Rd, Middletown, MD, 21769

in directory

Open Book Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

OPEN THOUGHT RETAIL PRIVATE LIMITED

📍 Telangana, India

in directory

OPEN THOUGHT RETAIL PRIVATE LIMITED — an NPOP-certified organic operator in Telangana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatelangana

Orange Factory

in directory

Orange Factory — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

ORGANIC SIKKIM GROWER GROUP - PETCHREK MARTAM, WEST SIKKIM

📍 Sikkim, India

in directory

ORGANIC SIKKIM GROWER GROUP - PETCHREK MARTAM, WEST SIKKIM — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

ORGANIC SIKKIM GROWER GROUP - PETCHREK MARTAM, WEST SIKKIM

📍 Sikkim, India

in directory

ORGANIC SIKKIM GROWER GROUP - PETCHREK MARTAM, WEST SIKKIM — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

Oriana's Orchard

📍 Winslow, IL, 61089

in directory

Oriana's Orchard — a Certified Naturally Grown produce and flowers operation in Winslow, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Orsi Organic Produce

📍 Juneau, AK, 99801

in directory

Orsi Organic Produce — a Certified Naturally Grown produce and flowers operation in Juneau, AK. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Oso Honey Farm

in directory

Oso Honey Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Our Farm

📍 1590 Peth Road, Manlius, NY, 13104

in directory

Our Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Our Little Orchard

📍 2226 Zion Road, Bellefonte, PA, 16823

in directory

Our Little Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Outhouse Orchards

📍 139 Hardscrabble Road, North Salem, NY, 10560

in directory

Outhouse Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Overholt's Farm Matket

📍 14520 Old State Hwy 13, 37078

in directory

Overholt's Farm Matket — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Owl Wood Farm

📍 Salem, NY, 12865

in directory

Owl Wood Farm — a Certified Naturally Grown produce and flowers operation in Salem, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Owl's Nest Farm

📍 Upper Marlboro, MD, 20774

in directory

Owl's Nest Farm — a Certified Naturally Grown produce and flowers operation in Upper Marlboro, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Owl's Roost Farm

📍 Rockford, IL, 61107

in directory

Owl's Roost Farm — a Certified Naturally Grown produce and flowers operation in Rockford, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Oxbow Farmstand

in directory

Oxbow Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Ozark Mountain Organics

📍 Springdale, AR, 72764

in directory

Ozark Mountain Organics — a Certified Naturally Grown produce and flowers operation in Springdale, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Ozark Prime Beef

in directory

Ozark Prime Beef — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

P-Nuts peanut stand

in directory

P-Nuts peanut stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

PACHHAD ORGANIC GROWERS GROUP

📍 Himachal Pradesh, India

in directory

PACHHAD ORGANIC GROWERS GROUP — an NPOP-certified organic operator in Himachal Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiahimachal-pradesh

Padilla Bay Farm

📍 Mount Vernon, WA, 98273

in directory

Padilla Bay Farm — a Certified Naturally Grown produce and flowers operation in Mount Vernon, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Paideia School Farm

📍 Atlanta, GA, 30316

in directory

Paideia School Farm — a Certified Naturally Grown produce and flowers operation in Atlanta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Painted Quarter Ranch

in directory

Painted Quarter Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Painted Turtle Farm Gettysburg College

📍 Gettysburg, PA, 17325

in directory

Painted Turtle Farm Gettysburg College — a Certified Naturally Grown produce and flowers operation in Gettysburg, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

PALI JAIVIK UTPADAK SAMITI 28 PBN

📍 Rajasthan, India

in directory

PALI JAIVIK UTPADAK SAMITI 28 PBN — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Palizzi Farmstand

📍 15380 East Bromley Lane, Brighton, CO, 80601

in directory

Palizzi Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Pancho's Wild Blueberries farm

in directory

Pancho's Wild Blueberries farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

PANICLE WORLDWIDE PRIVATE LIMITED

📍 Delhi, India

in directory

PANICLE WORLDWIDE PRIVATE LIMITED — an NPOP-certified organic operator in Delhi, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiadelhi

Panorama Orchards & Farm Market

📍 63 Talona Spur, Ellijay, GA, 30540

in directory

A century-old family fruit farm in Ellijay, GA — North Georgia mountains, southern Appalachians. Established in the 1920s, transitioned from wholesale orchard to diversified retail in 1983 with the construction of an on-site apple-packing line, 10,000-bushel cold storage, bakery kitchens, and retail sales floor. Produces over 20 apple varieties plus peaches, seasonal strawberries, and fall vegetables. Retail features apples, fried pies, baked goods, homemade fudge, and ice cream.

orchardapplespeachesstrawberries

Pappy's Orchard & Lisa's Kitchen

📍 2576 Cassel Road, Coopersburg, PA, 18036

in directory

Pappy's Orchard & Lisa's Kitchen — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Paradox Farm

📍 Lexington, VA, 24450

in directory

Paradox Farm — a Certified Naturally Grown produce and flowers operation in Lexington, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Parampalli Resorts LLP

📍 Karnataka, India

in directory

Parampalli Resorts LLP — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Park Hill Orchards

in directory

Park Hill Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Parlee Farms

📍 95 Farwell Road, Tyngsboro, 01879

in directory

Tyngsboro, MA pick-your-own farm running multi-crop PYO across strawberries, cherries, blueberries, peaches, and apples, plus 10+ acres of non-GMO sweet corn. Farmstand carries on-farm fruit alongside in-house bakery, honey, and jam.

vegetable-farmorchardberry-farmpick-your-own

Parmenter's Northville Cider Mill

📍 714 Baseline Road, Northville, MI, 48167

in directory

Parmenter's Northville Cider Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

ParTake Kitchen

📍 540 Blake Avenue, 44256

in directory

ParTake Kitchen — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

PARVATA FOODS PRIVATE LIMITED

📍 West Bengal, India

in directory

PARVATA FOODS PRIVATE LIMITED — an NPOP-certified organic operator in West Bengal, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiawest-bengal

Pasolivo Olive Oil

📍 8530 Vineyard Drive, Paso Robles, CA (estate); tasting room at 1229 Park Street, Paso Robles

in directory

Pasolivo is a single-origin estate olive farm in Paso Robles, CA — 7,000 olive trees on 45 acres of limestone-rich Central Coast hills, family-owned and -operated since 2001. Sustainably farmed with organic practices and COOC-certified extra virgin olive oil after each harvest.

olive-orchardsingle-originestate-grownfamily-owned

Passion to Seed Gardening

📍 Gaithersburg, MD, 20882

in directory

Passion to Seed Gardening — a Certified Naturally Grown produce and flowers operation in Gaithersburg, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Pat's Peaches

in directory

Pat's Peaches — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Patchwork City Farms, LLC.

📍 Atlanta, GA, 30310

in directory

Patchwork City Farms, LLC. — a Certified Naturally Grown produce and flowers operation in Atlanta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Patchwork Farms

in directory

Patchwork Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Paugh's Orchard

📍 5591 Senedo Road, Quicksburg, VA, 22847-1100

in directory

Paugh's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Paul Mazza's Fruit & Vegetables

📍 182 River Road, VT

in directory

Forty-plus-year Vermont produce operation farming 250+ acres across Essex, Jericho, Williston, and Colchester — supplying CSAs, pick-your-own, grocery stores, and farm stands throughout Vermont.

vegetable-farmcsapick-your-ownvermont

Paulus Farm Market

📍 1216 South York Street, Mechanicsburg, PA, 17050

in directory

Paulus Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Paulus Orchard

📍 522 East Mount Airy Road, Dillsburg, 17019

in directory

Paulus Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Peace and Harmony Farm

📍 Meadows of Dan, VA, 24120

in directory

Peace and Harmony Farm — a Certified Naturally Grown produce and flowers operation in Meadows of Dan, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Peaceful Valley Maple Farms

in directory

Peaceful Valley Maple Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Peach Creek Country Market

in directory

Peach Creek Country Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Peach Pit Farms

📍 Lithia, FL, 33547

in directory

Peach Pit Farms — a Certified Naturally Grown produce and flowers operation in Lithia, FL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Peachy Sprouts

📍 Stockbridge, GA, 30281

in directory

Peachy Sprouts — a Certified Naturally Grown produce and flowers operation in Stockbridge, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Peak Produce LLC

📍 Concord, NC, 28025

in directory

Peak Produce LLC — a Certified Naturally Grown produce and flowers operation in Concord, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Pearce Farm Market

📍 5740 West North Walworth Road, Walworth, 53184

in directory

Pearce Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Peasant Revolt Farm

📍 Cherry Valley, IL, 61016

in directory

Peasant Revolt Farm — a Certified Naturally Grown produce and flowers operation in Cherry Valley, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Peasants Parcel

📍 Paw Paw, WV, 25434

in directory

Peasants Parcel — a Certified Naturally Grown mushrooms operation in Paw Paw, WV. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Pecan Outlet

📍 3743 Madison Highway, Valdosta, GA, 31601

in directory

Pecan Outlet — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Peches

in directory

Peches — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Pendland's Apple House

📍 41 Talona Spur, Ellijay, GA, 30540

in directory

Pendland's Apple House — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Pepe's Produce and Taco Stand

📍 907 Main Street, Ramona, CA, 92065

in directory

Pepe's Produce and Taco Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Perdue Homestead Farm

📍 Edgerton, MO, 64444

in directory

Perdue Homestead Farm — a Certified Naturally Grown produce and flowers operation in Edgerton, MO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Perkins Orchard

📍 5749 Barbee Road, Durham, NC, 27713

in directory

Perkins Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Permaculture Gardens LLC

📍 Leeburg, VA, 20176

in directory

Permaculture Gardens LLC — a Certified Naturally Grown produce and flowers operation in Leeburg, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Perry Lowe Farm Store

📍 8741 North Carolina 16, Moravian Falls, NC, 28654

in directory

Perry Lowe Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Peskar Farms

📍 2414 160th Avenue, Town of Emerald, 54013

in directory

Peskar Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Petals Farm & Garden Offerings

📍 Huntley, IL, 60142

in directory

Petals Farm & Garden Offerings — a Certified Naturally Grown produce and flowers operation in Huntley, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Pete's Greens

📍 9 Pete's Greens Road, Craftsbury, VT, 05826

in directory

A certified-organic four-season vegetable farm in Craftsbury, on the edge of Vermont's Northeast Kingdom — growing and distributing organic vegetables year-round in a place with one of the shortest growing seasons in the continental US. Operates the Good Eats CSA with multiple pickup locations, a farmstand on the farm, and a wholesale line into Vermont restaurants, retailers, and institutions.

vegetable-farmcertified-organicfour-seasoncsa

Peter's Orchard

📍 10540 Carlisle Pike, Huntington Township, PA, 17324

in directory

Family-operated fruit and vegetable farm in Gardners, PA, in operation since 1870. Uses Integrated Pest Management, with active affiliation to Adams Food Policy and the Pennsylvania Apples / PA Preferred programs.

orchardipmheritage-operationmulti-generational

Petershiem Farm & Market

📍 16362 Drake Hill Road, Townville, PA, 16360

in directory

Petershiem Farm & Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Peterson Farm and Dalahäst Roasting Co.

in directory

Peterson Farm and Dalahäst Roasting Co. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Petit Teton Farm

📍 18601 Highway 128, Yorkville, CA, 95494

in directory

Petit Teton Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Phalada Agro Research Foundations Pvt Ltd

📍 Karnataka, India

in directory

Phalada Agro Research Foundations Pvt Ltd — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Pheasant Fields Farm

📍 13274 Clear Creek Road Northwest, Silverdale, WA, 98383

in directory

Pheasant Fields Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Phillips Market

📍 3000 Vine Street

in directory

Phillips Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Phillips Orchards & Cider Mill

📍 1174 West Gratiot County Line Road

in directory

Phillips Orchards & Cider Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Philo Ridge Farm and Market

📍 2766 Mount Philo Road, Charlotte, VT, 05445

in directory

Philo Ridge Farm and Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Phipps Country Store and Farm

📍 2700 Pescadero Road, Pescadero, 94060

in directory

Phipps Country Store and Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Phoenix Gardens, LLC

📍 Lawrenceville, GA, 30045

in directory

Phoenix Gardens, LLC — a Certified Naturally Grown produce and flowers operation in Lawrenceville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Pick'n Patch

in directory

Pick'n Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Pie Ranch

📍 2080 Cabrillo Highway, Pescadero, CA, 94060

in directory

Pie Ranch is a 501(c)(3) nonprofit regenerative farm in Pescadero, CA, advancing food education, regenerative agriculture, and community collaborations. 250,000 native plants planted, 16,000 lbs of food grown annually, youth internships and field trips, on-site farmstand, and a Cascade Regenerator network of partner farms.

regenerativenonprofitnative-plantsfood-education

Piedmont Power

in directory

Piedmont Power — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Pierson Orchard

📍 5348 North State Road, Ionia, MI, 48846

in directory

Pierson Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Pig & Leaf

📍 Summertown, TN, 38483

in directory

Pig & Leaf — a Certified Naturally Grown produce and flowers operation in Summertown, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Pine Bluff Farmstand

in directory

Pine Bluff Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Pine Creek Lavender Farm

📍 Pine, AZ, 85544

in directory

Pine Creek Lavender Farm — a Certified Naturally Grown produce and flowers operation in Pine, AZ. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Pine Creek Lavender Farm Store and Cooking School

📍 4223 North Pine Creek Canyon Road, 85544

in directory

Pine Creek Lavender Farm Store and Cooking School — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

Pine Hill Egg Ranch

in directory

Pine Hill Egg Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Pine Hill Orchard

📍 5682 State Hwy 167, Hubertus, WI, 53033

in directory

Pine Hill Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Pine O Mine Ranch

📍 2620 Carson Road, Placerville, CA

in directory

Pine O Mine Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Pine Ridge Apiaries LLC

📍 Crawford, NE, 69339

in directory

Pine Ridge Apiaries LLC — a Certified Naturally Grown apiary operation in Crawford, NE. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Pine Tree Apple Orchard

📍 450 Apple Orchard Road, White Bear Lake

in directory

Pine Tree Apple Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Pinewood Springs Farm

📍 Stockbridge, GA, 30281

in directory

Pinewood Springs Farm — a Certified Naturally Grown produce and flowers operation in Stockbridge, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Pink Moon Farm

📍 Eatonville, WA, 98328

in directory

Pink Moon Farm — a Certified Naturally Grown produce and flowers operation in Eatonville, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Pippin Orchard

in directory

Pippin Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Pit Stop Produce (seasonal)

in directory

Pit Stop Produce (seasonal) — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Plant A Row For The Hungry (On The MacMillen Property)

📍 Marietta, GA, 30064

in directory

Plant A Row For The Hungry (On The MacMillen Property) — a Certified Naturally Grown produce and flowers operation in Marietta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Plant It Forward

in directory

Plant It Forward — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Plant Lab

📍 208 West 18th Street

in directory

Plant Lab — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

PLANTONORGANIC EXPERIENCE CENTRE PRIVATE LIMITED

in directory

PLANTONORGANIC EXPERIENCE CENTRE PRIVATE LIMITED — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Pleasant Ridge Farm

in directory

Pleasant Ridge Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Pleasant Springs Orchard

📍 2722 Williams Drive

in directory

Pleasant Springs Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Pleasant Valley Farm

📍 Argyle, NY, 12809

in directory

Pleasant Valley Farm — a Certified Naturally Grown produce and flowers operation in Argyle, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Plentiful Farm

📍 Spotsylvania, VA, 22551

in directory

Plentiful Farm — a Certified Naturally Grown produce and flowers operation in Spotsylvania, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

PLR FOODS PRIVATE LIMITED

📍 Andhra Pradesh, India

in directory

PLR FOODS PRIVATE LIMITED — an NPOP-certified organic operator in Andhra Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiaandhra-pradesh

Pocono Mountain Farms

📍 Newfoundland, Pennsylvania 18445 (Wayne County)

in directory

Pennsylvania's largest organic maple-syrup operation, based in Newfoundland, Pennsylvania (Wayne County), tapping roughly 24,000 sugar maples per season and producing certified-organic, kosher, small-batch maple syrup at substantial commercial scale. The operation works the upper end of the maple-production scale spectrum while maintaining organic certification — a notable demonstration that organic-certified maple production can scale beyond the small-family-bush range without compromising the certification.

maple-syruporganickosherscale

Pocono Organics

260 ac

📍 Long Pond, Pennsylvania (Monroe County)

in directory

A 260-acre Regenerative Organic Certified farm at Long Pond, Pennsylvania, on the Pocono Plateau next to Pocono Raceway. Founded 2017 by Ashley Walsh; Rodale Institute is the agronomic research partner. Produces vegetables, herbs, hemp, and CBD product lines, and runs an on-site cafe and market. One of the largest Regenerative Organic Certified operations in the northeastern United States.

regenerativeorganiccsapennsylvania

Pointer Hollow Farm

📍 2164 Salem Road, 18036

in directory

Pointer Hollow Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Polyface Farm

550 ac

📍 Swoope, Virginia, USA (Augusta County, Shenandoah Valley)

in directory

The Salatin family's 550-acre Virginia farm — the most-cited working example of pasture-based, rotationally-grazed, multi-species regenerative livestock production in North America. Joel Salatin calls it "beyond organic." Michael Pollan made it famous.

regenerativerotational-grazinglivestockmulti-species

Pond Hill Farm

📍 Kittanning, PA, 16201

in directory

Pond Hill Farm — a Certified Naturally Grown produce and flowers operation in Kittanning, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Poor Boys Produce & Vegetable

📍 263 US-158, Camden, NC, 27921

in directory

Poor Boys Produce & Vegetable — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Pope Farms

📍 6501 28th Street, Greeley, CO, 80634

in directory

Pope Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Pope’s Strawberry Farm

📍 1305 Fayetteville Street, Knightdale, NC, 27545

in directory

Pope’s Strawberry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Porter Farms & Nursery Farm Market

📍 7615 Ten Ten Road, Raleigh, NC, 27603

in directory

Porter Farms & Nursery Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Poston Family Garlic Farm

📍 Humboldt, TN, 38343

in directory

Poston Family Garlic Farm — a Certified Naturally Grown produce and flowers operation in Humboldt, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Potomac Vegetable Farms

📍 9627 Leesburg Pike, Vienna, VA, 22182

in directory

A 50+ year working diversified vegetable farm operating two locations in Northern Virginia — a Vienna farm and stand on Route 7 (4 miles west of Tysons Corner) and a Purcellville farm on Route 287. Practices Ecoganic — organic methods without formal certification. Sells through two on-farm stands, a multi-farm CSA program (June through fall), and area farmers markets.

ecoganicvegetablecsafarm-stand

Poughkeepsie Farm Project

📍 Poughkeepsie, NY, 12603

in directory

Poughkeepsie Farm Project — a Certified Naturally Grown produce and flowers operation in Poughkeepsie, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Powell's Roadside Market

📍 2138 US-158, Moyock, NC, 27958

in directory

Powell's Roadside Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Powers' Farm

in directory

Powers' Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Prairie Woods Farm

📍 Sulphur Springs, AR, 72768

in directory

Prairie Woods Farm — a Certified Naturally Grown produce and flowers operation in Sulphur Springs, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Prakrutees Organics Private Limited

📍 Karnataka, India

in directory

Prakrutees Organics Private Limited — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

PRATHISTA INDUSTRIES LIMITED

📍 Telangana, India

in directory

PRATHISTA INDUSTRIES LIMITED — an NPOP-certified organic operator in Telangana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatelangana

Pregitzer Farm Market

in directory

Pregitzer Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Preston's Paradise

📍 839 North Preston Street, Philadelphia, PA

in directory

Preston's Paradise — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

PRIDE ORGANIC EXPORTS

📍 Tamil Nadu, India

in directory

PRIDE ORGANIC EXPORTS — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Pristine Organics Private Limited

📍 Karnataka, India

in directory

Pristine Organics Private Limited — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

PRISTINE ORGANICS PVT. LTD.

📍 Karnataka, India

in directory

PRISTINE ORGANICS PVT. LTD. — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Produce Junction

in directory

Produce Junction — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Produce Ridge

📍 195 Orchard Lane, Pioneer, LA, 71266

in directory

Produce Ridge — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Produce Shack

in directory

Produce Shack — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Produce Stands

in directory

Produce Stands — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Produce Tent

📍 392 East Avalon Street, Kuna, ID, 83634

in directory

Produce Tent — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Promised Land

📍 13900 Tech City Cir, Alachua, FL, 32615-6090

in directory

Promised Land — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Providence Farm

📍 2569 Huffine Mill Road, McLeansville, NC

in directory

Providence Farm is a multi-species regenerative, predator-friendly operation in McLeansville, NC (Carolina Piedmont). Heritage breeds — Tamworth pigs, Romeldale CVM sheep, Mini Lamancha dairy goats, Tunis sheep — plus free-range poultry, livestock guardian dogs, and a value-added line of wool and goat-milk soaps.

livestock-farmregenerativepredator-friendlyheritage-breeds

Pumpkin

in directory

Pumpkin — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Pumpkin Hill Farm

in directory

Pumpkin Hill Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Pumpkin Patch Bonita, Pumpkins Bonita

📍 5354 Bonita Road

in directory

Pumpkin Patch Bonita, Pumpkins Bonita — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Pumpkin Pyle

📍 900 North 2nd Street, Floydada, TX, 79235

in directory

Pumpkin Pyle — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Pyrah's Pioneer Peak Farm

in directory

Pyrah's Pioneer Peak Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Q-P Farm Market

in directory

Q-P Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Quiet Valley Living Historical Farm

114 ac

📍 Stroudsburg, Pennsylvania (Monroe County)

in directory

A 114-acre living-history farm and museum in Stroudsburg, Pennsylvania, preserving and operating an 18th–19th-century Pennsylvania German farmstead. Founded as a public-facing institution in 1963 by the Zepper family, who farmed the property since 1772 and donated it for educational use. The farm operates with period-appropriate methods — heritage breeds, hand tools, draft animals, root cellars, smokehouses — and maintains the original house, barn, springhouse, and outbuildings as the working environment for staff and volunteers in 1830s-period dress. The Pocono region's strongest analog to Staten Island's Decker Farm: a continuously-farmed property holding the bioregion's pre-industrial agricultural memory in the only way it can be held — by keeping it operating.

heritageliving-historypennsylvania-germanpennsylvania

R & A Orchards

📍 5505 GA 52, Ellijay, GA, 30536

in directory

R & A Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

R J Daniels

📍 8094 Fairgrounds Road, Belvidere, IL, 61008

in directory

R J Daniels — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

R&R Secret Flowers

📍 Athens, GA, 30606

in directory

R&R Secret Flowers — a Certified Naturally Grown produce and flowers operation in Athens, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

R&S Farm Meats

📍 140 Colville Road, Mooresville, NC, 28117

in directory

R&S Farm Meats — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

R&W Grocery

in directory

R&W Grocery — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Radio Farm

📍 Bethany, CT, 06524

in directory

Radio Farm — a Certified Naturally Grown produce and flowers operation in Bethany, CT. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Radke's Blueberries

in directory

Radke's Blueberries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Rae's Farmer Market

in directory

Rae's Farmer Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Raid Rngi Organic Producers Cooperative Society Ltd

📍 Meghalaya, India

in directory

Raid Rngi Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Railrose Garden Farm

📍 Panola, MS, 38619

in directory

Railrose Garden Farm — a Certified Naturally Grown produce and flowers operation in Panola, MS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rain Shadow Lavender Farm

📍 Sequim, WA, 98382

in directory

Rain Shadow Lavender Farm — a Certified Naturally Grown produce and flowers operation in Sequim, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rainfield Farm

📍 New Carlisle, IN, 46552

in directory

Rainfield Farm — a Certified Naturally Grown produce and flowers operation in New Carlisle, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rakowski Family Farm Market

in directory

Rakowski Family Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

RALANG - BARFUNG -BAKHIM

📍 Sikkim, India

in directory

RALANG - BARFUNG -BAKHIM — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

Ralph's Cherry Hut

in directory

Ralph's Cherry Hut — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

RAMONA COSMACEUTICALS Pvt. LIMITED

📍 Tamil Nadu, India

in directory

RAMONA COSMACEUTICALS Pvt. LIMITED — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Ranchers Feed

📍 354 1st St, Hollister, 95023-3713

in directory

Ranchers Feed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Rancho Siempre Verde

📍 2250 Cabrillo Highway, Pescadero, CA

in directory

Rancho Siempre Verde is a 55+ year family-operated coastal farm in Pescadero, CA growing organic produce year-round, with seasonal pumpkin and Christmas-tree festivals. Festival proceeds fund the Phoenix Food Project, donating produce to food-insecure community members via local pantries.

family-farmorganicfood-accesspumpkin-patch

Randives Organic Farm

📍 Maharashtra, India

in directory

Randives Organic Farm — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Ranikor Organic Producers Cooperative Society Ltd

📍 Meghalaya, India

in directory

Ranikor Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Ranke Family Farms

in directory

Ranke Family Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

RAPID ORGANIC PVT .LTD.

📍 Rajasthan, India

in directory

RAPID ORGANIC PVT .LTD. — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Rappahannock Education Farm

📍 Greater Fredericksburg Region, Virginia, USA

in directory

A 9-acre 501(c)(3) nonprofit working farm in the Greater Fredericksburg, Virginia region — grows fresh produce specifically to donate to the regional food bank and local food pantries, while running agricultural-education programs for volunteers and the wider community. Volunteer-based labor model; aims to reduce food insecurity by growing-and-donating rather than by aid-and-grocery.

nonprofitfood-justicefood-bankagricultural-education

Raptor Creek Farm

in directory

Raptor Creek Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

RAVANDE FARMERS PRODUCER COMPANY LIMITED

📍 Maharashtra, India

in directory

RAVANDE FARMERS PRODUCER COMPANY LIMITED — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Rawson's Farm

in directory

Rawson's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Ray Of Sunshine

in directory

Ray Of Sunshine — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Ray's Produce & Seafood World

📍 400 Vinson Boulevard, Whiteville, NC, 28472

in directory

Ray's Produce & Seafood World — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Red Apple Farm

📍 455 Highland Avenue, Phillipston, MA, 01331

in directory

A 4th-generation working orchard in Phillipston, MA — central Massachusetts, established 1912. Sited at 1,250 ft elevation, giving the orchard the cool nights that produce extra-crisp coloring on the apples. Grows 50+ apple varieties plus peaches, pears, blueberries, raspberries, sunflowers, pumpkins, ornamental corn, popcorn, and potatoes. Operations include U-pick across the seasons, an on-site country store, hayrides, farm animals, the Brew Barn, a Cidery, a BBQ pit and restaurant, and a country-barn wedding venue. Also a vendor at Boston Public Market.

orchardapplespeachespears

Red Chair Lavender

📍 2729 North Haven Drive, Eagle, ID, 83616-2331

in directory

Red Chair Lavender — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

Red Fern Farm

📍 Floyd, VA, 24091

in directory

Red Fern Farm — a Certified Naturally Grown produce and flowers operation in Floyd, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Red Sky Farm

📍 613 VT Route 73, Orwell, VT, 05760

in directory

Red Sky Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Red Top Market

in directory

Red Top Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Red's Quality Acre, LLC

📍 Durham, NC, 27705

in directory

Red's Quality Acre, LLC — a Certified Naturally Grown produce and flowers operation in Durham, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Reddi Cut Potatoes

📍 6307 Seymour Highway, Wichita Falls, TX, 76310

in directory

Reddi Cut Potatoes — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Redwing Farm

📍 Mickleton, NJ, 08056

in directory

Redwing Farm — a Certified Naturally Grown produce and flowers operation in Mickleton, NJ. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Redwood Farm

📍 Durham, NC, 27704

in directory

Redwood Farm — a Certified Naturally Grown produce and flowers operation in Durham, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Reeves

📍 1220 West Genesee Road, Baldwinsville

in directory

Reeves — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Regeanic Sustainable Chilli Growers Group

📍 Tamil Nadu, India

in directory

Regeanic Sustainable Chilli Growers Group — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Regeneration Farm, LLC

📍 Brodhead, WI, 53520

in directory

Regeneration Farm, LLC — a Certified Naturally Grown produce and flowers operation in Brodhead, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Reinders Property

📍 Lovettsville, VA, 20180

in directory

Reinders Property — a Certified Naturally Grown produce and flowers operation in Lovettsville, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Reinke

in directory

Reinke — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

REITZEL INDIA PRIVATE LIMITED

📍 Karnataka, India

in directory

REITZEL INDIA PRIVATE LIMITED — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Rendleman Orchards Farm Market

📍 9680 IL 127, Alto Pass, IL, 62905

in directory

Rendleman Orchards Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Retherford's Village Farm Market and Antiques

📍 4090 Maple Grove Road, Benton, PA, 17814

in directory

Retherford's Village Farm Market and Antiques — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Reynolds Farm

in directory

Reynolds Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Rhonda's Blueberries

📍 Union Point, GA, 30669

in directory

Rhonda's Blueberries — a Certified Naturally Grown produce and flowers operation in Union Point, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rhubarb Botanicals LLC

📍 Springville, IA, 52336

in directory

Rhubarb Botanicals LLC — a Certified Naturally Grown produce and flowers operation in Springville, IA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Richard Levenson CPA

📍 6023 US Route 5, Westminster, VT, 05158

in directory

Richard Levenson CPA — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Richard's Farm Market

in directory

Richard's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Richard's Farmstand

📍 411 West Cascade Avenue, Sisters, OR, 97759

in directory

Richard's Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Ricky's Brand

📍 57-146 Kamehameha Highway, Kahuku, HI, 96731-2156

in directory

Ricky's Brand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Ridgebury Country Deli

📍 677

in directory

Ridgebury Country Deli — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Riehm Produce Farm

📍 7244 North State Route 53, 44883

in directory

Riehm Produce Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Ringgi Demdema Organic Producers Cooperative Society Ltd

in directory

Ringgi Demdema Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Rinker Orchards Inc.

in directory

Rinker Orchards Inc. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Rising Herb Farm

📍 Centerpoint, IN, 47840

in directory

Rising Herb Farm — a Certified Naturally Grown produce and flowers operation in Centerpoint, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rising Sun Farms

📍 5126 South Pacific Highway, Phoenix, OR, 97535

in directory

Rising Sun Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

Rising Tide Farm

📍 Juneau, AK, 99801

in directory

Rising Tide Farm — a Certified Naturally Grown produce and flowers operation in Juneau, AK. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rissers Farm Market

in directory

Rissers Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Ritter's Cider Mill

📍 117 Wimmer's Road, Mount Cobb, PA, 18436

in directory

A family-owned cider mill, orchard, and fall-season agritourism operation at 117 Wimmer's Road in Mount Cobb, PA — Lackawanna County, Pocono region. The Ritter family has been making cider since 1978. Press their own apple cider on-site (currently un-pasteurized), 20 apple varieties retail, an on-site bakery (cider donuts, cookies, pies, caramel apples), Hay Barn, corn maze, friendly farm animals, scenic hayrides every weekend through fall. Open the first Saturday after Labor Day through December 23.

orchardcider-millcider-donutsapples

Ritter's Farm Market

in directory

Ritter's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

River Queen Greens

📍 New Orleans, LA, 70117

in directory

River Queen Greens — a Certified Naturally Grown produce and flowers operation in New Orleans, LA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Riverside Specialty Farm

📍 West Fork, AR, 72774

in directory

Riverside Specialty Farm — a Certified Naturally Grown produce and flowers operation in West Fork, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Riverstone Organic Farm

📍 708 Thompson Road SE, Floyd, VA, 24091

in directory

Riverstone Organic Farm in Floyd County, VA (Southern Appalachians) grows certified-organic produce year-round, distributed through an honor-system farm store, CSA, online ordering, and wholesale. The store also curates pasture-raised meat, eggs, bread, and artisan goods from regional producers.

vegetable-farmcertified-organicusda-organiccsa

Riverview Farms, LLC

📍 Arden, NC, 28704

in directory

Riverview Farms, LLC — a Certified Naturally Grown produce and flowers operation in Arden, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

RMM FOOD PRODUCTS PRIVATE LIMITED

📍 Andhra Pradesh, India

in directory

RMM FOOD PRODUCTS PRIVATE LIMITED — an NPOP-certified organic operator in Andhra Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiaandhra-pradesh

Roadside fresh fruit and boiled peanuts! Recommended!

📍 205 Badin Lake Road, New London, NC, 38138

in directory

Roadside fresh fruit and boiled peanuts! Recommended! — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Roadside Market

in directory

Roadside Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Roadside Produce & Market

in directory

Roadside Produce & Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Robertson Family Farm

📍 390 Mountain View Road, King, NC, 27052

in directory

Robertson Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Robinette's Cider Mill

in directory

Robinette's Cider Mill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Robinson Heritage Farm

📍 Dawsonville, GA, 30534

in directory

Robinson Heritage Farm — a Certified Naturally Grown produce and flowers operation in Dawsonville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Roche Farmstand

📍 600 Waverley Road

in directory

Roche Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Rock 'n Roots Farm

📍 Paonia, CO, 81428-7111

in directory

Rock 'n Roots Farm — a Certified Naturally Grown produce and flowers operation in Paonia, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rock Harvest Farm

📍 New Braintree, MA, 01531

in directory

Rock Harvest Farm — a Certified Naturally Grown produce and flowers operation in New Braintree, MA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rocklands Farm Winery

📍 14531 Montevideo Road, Poolesville, MD, 20837

in directory

Rocklands Farm Winery is a 34-acre family-owned working farm and winery in Poolesville, MD (Montgomery County), founded 2010. Low-intervention, handcrafted wines from Maryland and Mid-Atlantic fruit; Slow Food DC affiliated.

vineyardwinerylow-intervention-wineslow-food

Rockside Ranch

📍 2421 N State Highway 3, Etna, CA, 96027

in directory

Rockside Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Rocky Mountain Garlic

📍 Salida, CO, 81201

in directory

Rocky Mountain Garlic — a Certified Naturally Grown produce and flowers operation in Salida, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rocky Ridge Greenhouse

in directory

Rocky Ridge Greenhouse — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Rocky road

in directory

Rocky road — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Rodichok Farm

in directory

Rodichok Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Rodin Farms

in directory

Rodin Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Roe's Orchard

📍 3276 State Route 94, Chester, NY, 10918

in directory

Roe's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Roeske Farms

📍 2656 Clark Rd, Hartland, MI, 48353

in directory

Roeske Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Rogers Orchards store

in directory

Rogers Orchards store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Rolling Green Farm Market

in directory

Rolling Green Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Rongkuchak-I Organic Producer Cooperative Society Ltd

in directory

Rongkuchak-I Organic Producer Cooperative Society Ltd — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Rongkuchak-II Organic Producer Cooperative Society Ltd

in directory

Rongkuchak-II Organic Producer Cooperative Society Ltd — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Rongsang Dadenggre Organic Producers Cooperative Society Ltd

in directory

Rongsang Dadenggre Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Ronnie's Berry Farm

📍 18409 NC-210, Angier, NC, 27501

in directory

Ronnie's Berry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Rooster Dirt Farm

📍 Eastern Panhandle WV / Northern VA / South-Central PA (farmers markets in Leesburg, Shepherdstown, McConnellsburg)

in directory

Rooster Dirt Farm is a regenerative multi-species meat operation in the Appalachian region (farmers markets in Leesburg VA, Shepherdstown WV, McConnellsburg PA). Mangalitsa pork (acorn-finished heritage breed), pasture-raised soy-free non-GMO chicken, grass-fed beef, eggs, and mushrooms; chemical-free production on diverse mountain pastures.

livestock-farmregenerativeheritage-breedmangalitsa

Root Down Farm

📍 2601 Cloverdale Road

in directory

A pastured poultry and pork operation in coastal Northern California, selling fresh and frozen chicken, duck, turkey, and pork direct at two of San Francisco's anchor farmers markets (Ferry Plaza Saturdays, Clement Street Sundays). On-farm pickup by appointment for buyers willing to drive.

poultry-farmlivestock-farmpasturedfarmers-market

Root Rock Farm, LLC

📍 Eckert, CO, 81418

in directory

Root Rock Farm, LLC — a Certified Naturally Grown produce and flowers operation in Eckert, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rooted Acres, LLC

📍 Worcester, NY, 12197

in directory

Rooted Acres, LLC — a Certified Naturally Grown produce and flowers operation in Worcester, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Roothouse Aquaponics

📍 Batavia, OH, 45103

in directory

Roothouse Aquaponics — a Certified Naturally Grown aquaponics operation in Batavia, OH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownaquaponicsecologicalsubstrate-builder

Roots 'n Shoots

📍 Arlington, VA, 22206

in directory

Roots 'n Shoots — a Certified Naturally Grown produce and flowers operation in Arlington, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rose's Berry Farm

📍 1200 Hebron Avenue, Glastonbury, CT, 06033

in directory

Connecticut's largest blueberry farm — 40+ acres of blueberry plants in South Glastonbury, opened 1908, pesticide-free and round-up-free under family ownership since 2022. Pick-your-own seasonal — blueberries, strawberries, raspberries, blackberries, apples, peaches, and pumpkins. Famous for its Breakfast-With-A-View program every Sunday morning during the season, served on a deck overlooking the farm.

orchardberriesblueberriesstrawberries

Round Up Feed

in directory

Round Up Feed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Rual Hill Farm

in directory

Rual Hill Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Rudd Farm

📍 4029 Hicone Road

in directory

Rudd Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Ruke’s Fruits & Vegetables

📍 378 Mathis Ferry Road, Mount Pleasant, SC, 29464

in directory

Ruke’s Fruits & Vegetables — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Rulfs Orchard

📍 531 Bear Swamp Road, 12972

in directory

Family-owned New York orchard founded in 1952, beginning with four milk cows and three heifer calves and evolving into a diversified u-pick apples, berries, tomatoes, and pumpkins operation with greenhouses, bakery, and café.

orchardmulti-generationalfamily-ownedu-pick

Runnings

in directory

Runnings — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

RUPIYA FINNOVATIONS PRIVATE LIMITED

📍 Gujarat, India

in directory

RUPIYA FINNOVATIONS PRIVATE LIMITED — an NPOP-certified organic operator in Gujarat, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiagujarat

Rural king

📍 Old Troy Pike, 45424

in directory

Rural king — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Russel Farms

📍 1418 Hawleyton Turnpike, 18812

in directory

Russel Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Russel's U-Pick Blueberries

in directory

Russel's U-Pick Blueberries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Russell Orchards Farm and Winery

in directory

Russell Orchards Farm and Winery — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvineyard

Russo's Orchard Lane Farm

in directory

Russo's Orchard Lane Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Rusted gate farm

in directory

Rusted gate farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Rustic Road Farm

📍 Elburn, IL, 60119

in directory

Rustic Road Farm — a Certified Naturally Grown produce and flowers operation in Elburn, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Rutherford Farm

📍 Fayetteville, AR, 72704

in directory

Rutherford Farm — a Certified Naturally Grown produce and flowers operation in Fayetteville, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

S.A HERBAL BIOACTIVES LLP

in directory

S.A HERBAL BIOACTIVES LLP — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

S&J Produce Farms

📍 8126 Hwy 72 W, Madison, AL, 35758

in directory

S&J Produce Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

SABARMATI JAIVIK UTPADAK SAMITI 4 DBN

📍 Rajasthan, India

in directory

SABARMATI JAIVIK UTPADAK SAMITI 4 DBN — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Sabrhen Farm Roadside Market

📍 8359 Chestnut Street, Barto, PA, 19504

in directory

Sabrhen Farm Roadside Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Sacred Roots Herbal Sanctuary

📍 Shepherdstown, WV, 25443

in directory

Sacred Roots Herbal Sanctuary — a Certified Naturally Grown produce and flowers operation in Shepherdstown, WV. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

SADKA JAIVIK UTPADAK SAMITI 5 FDM

📍 Rajasthan, India

in directory

SADKA JAIVIK UTPADAK SAMITI 5 FDM — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

Safari Junction

in directory

Safari Junction — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Saffron World

📍 228 East Kerr Street, Salisbury, NC, 28144-4452

in directory

Saffron World — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

Saffron World Market

📍 27283 Waxhaw Parkway, Waxhaw, NC, 28173-7257

in directory

Saffron World Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

SAI SHENDRIYA SHETI SANSTHA

📍 Maharashtra, India

in directory

SAI SHENDRIYA SHETI SANSTHA — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Saint Fiacres Farm

📍 Cato, NY, 13033

in directory

Saint Fiacres Farm — a Certified Naturally Grown produce and flowers operation in Cato, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Saipung Organic Producers Cooperative Society Ltd (Group I)

📍 Meghalaya, India

in directory

Saipung Organic Producers Cooperative Society Ltd (Group I) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Saipung Organic Producers Cooperative Society Ltd (Group II)

📍 Meghalaya, India

in directory

Saipung Organic Producers Cooperative Society Ltd (Group II) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Salem Bottom Provisions

📍 1245 Donlar Dr, Westminster, MD, 21157

in directory

Salem Bottom Provisions — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Salt Air Farm

📍 1535 New Suffolk Road, Cutchogue, NY, 11935

in directory

A family-run flower-and-fruit farm on the North Fork of Long Island, between Cutchogue and New Suffolk, with the salt marshes and inlets of Peconic Bay as the working backdrop. Grows hydrangeas, fresh cut florals (April-October), specialty pumpkins, fruit trees, and herbs including lavender and rosemary. Operates as both a working farm and a wedding/garden-party venue, with a CSA, wholesale floral stems for off-site events, and on-farm floral design.

flower-farmcsaevent-venuenorth-fork

Salt Creek Cherries

in directory

Salt Creek Cherries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Salt Creek Valley Farms

in directory

Salt Creek Valley Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Salubrious Farms Stand

in directory

Salubrious Farms Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmushroom-farm

Salvaterra's Gardens

📍 9044 Mountain Road, Alburtis, PA, 18011

in directory

Salvaterra's Gardens is a family-owned certified-organic vegetable farm in Alburtis, PA (Lehigh Valley / Schuylkill Valley edge). Distribution via farm stand and CSA shares.

vegetable-farmcertified-organicusda-organicfamily-farm

Sam Mazza's Farm Market

in directory

Sam Mazza's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Samaha's Farm LLC.

in directory

Samaha's Farm LLC. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Samascott Orchards

📍 5 Sunset Avenue, Kinderhook, NY, 12106

in directory

Samascott Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Samish Bay Cheese

📍 15115 Bow Hill Road, Bow, WA, 98232

in directory

A certified-organic dairy on roughly 200 acres in northwestern Skagit County, Washington, milking a mixed herd that is mostly Milking Shorthorns — a heritage breed less common in modern commercial dairy. Operates an on-farm creamery turning the milk into a line of cheeses sold direct on the farm, at regional farmers markets, online, and through a growing list of retail outlets.

dairycertified-organicmilking-shorthornheritage-breed

SAMRUDDHI ORGANIC FARM INDIA PVT LTD

in directory

SAMRUDDHI ORGANIC FARM INDIA PVT LTD — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Sanders Field Farm

in directory

Sanders Field Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Sandhills Community College Culinary Gardens

📍 Pinehurst, NC, 28374

in directory

Sandhills Community College Culinary Gardens — a Certified Naturally Grown produce and flowers operation in Pinehurst, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sandhills Mushroom Farm

📍 975 Johnson Farm Road, Fayetteville, NC, 28311

in directory

Sandhills Mushroom Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmushroom-farm

Sandoe's

in directory

Sandoe's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Sands Avenue Community Farmstand

in directory

Sands Avenue Community Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Sandy Valley Farm

📍 632 Valley Road, Polk, PA, 16342

in directory

Sandy Valley Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sandy's Way Microfarm

📍 Sedalia, CO, 80135

in directory

Sandy's Way Microfarm — a Certified Naturally Grown produce and flowers operation in Sedalia, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

SANJEEV PRAJAPATI FARM

📍 Rajasthan, India

in directory

SANJEEV PRAJAPATI FARM — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

SANJEEVANI JAIVIK KIRSHAK VIKAS SAMITI

in directory

SANJEEVANI JAIVIK KIRSHAK VIKAS SAMITI — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Sapna Jaivik Kishan Seva Pal Road

📍 Rajasthan, India

in directory

Sapna Jaivik Kishan Seva Pal Road — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

SARA JAIVIK UTPADAK SAMITI 20 STB

📍 Rajasthan, India

in directory

SARA JAIVIK UTPADAK SAMITI 20 STB — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

SARAF TRADING CORPORATION PVT. LTD

📍 Tamil Nadu, India

in directory

SARAF TRADING CORPORATION PVT. LTD — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

SARDARPURA BIKA JAIVIK UTPADAK SAMITI 25 LGW

📍 Rajasthan, India

in directory

SARDARPURA BIKA JAIVIK UTPADAK SAMITI 25 LGW — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

SARTHANU PRODUCTS PRIVATE LIMITED

📍 Maharashtra, India

in directory

SARTHANU PRODUCTS PRIVATE LIMITED — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

SARWAM ORGANICS PRIVATE LIMITED

📍 Karnataka, India

in directory

SARWAM ORGANICS PRIVATE LIMITED — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Sarwam Organics Pvt Ltd

📍 Karnataka, India

in directory

Sarwam Organics Pvt Ltd — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Sasnett Fruit & Nuts

📍 3801

in directory

Sasnett Fruit & Nuts — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sassy Bee Honey, LLC

📍 Bellefonte, DE, 19809

in directory

Sassy Bee Honey, LLC — a Certified Naturally Grown apiary operation in Bellefonte, DE. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Sauder's Produce and Supply

📍 2511

in directory

Sauder's Produce and Supply — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Saunders Brothers Farm Market

📍 2717 Tye Brook Hwy, Piney River, VA, 22964

in directory

Saunders Brothers Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Savage creek farm

in directory

Savage creek farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Savage Gardens

📍 303 Savage Point Road, North Hero, VT, 05474

in directory

Savage Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Scarecrow Farm

📍 Hudson, NY, 12534

in directory

Scarecrow Farm — a Certified Naturally Grown produce and flowers operation in Hudson, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

SCG Market Garden

📍 Springfield, MO, 65802

in directory

SCG Market Garden — a Certified Naturally Grown produce and flowers operation in Springfield, MO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Schmitt's Country Fresh

📍 Main Road, Laurel, NY, 11948

in directory

Schmitt's Country Fresh — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Schmitt's Family Farm

📍 3 Bagatelle Road, Dix Hills, NY, 11746

in directory

Schmitt's Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Schmucker's Produce And Greenhouse

in directory

Schmucker's Produce And Greenhouse — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Scholl Orchards

📍 3057 Center Street, Bethlehem, PA, 18017

in directory

Scholl Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Schuh Farms

📍 15565 State Route 536, Mount Vernon, 98273

in directory

Schuh Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Schuylerville Apple Orchard

in directory

Schuylerville Apple Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Schwebach

in directory

Schwebach — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Schweizer Orchards

86 ac

📍 Saint Joseph, MO (east of Highway 169)

in directory

An 86-acre family-owned orchard just north of Saint Joseph, Missouri — four generations of apple production under the River Bend Apples label, plus U-pick blackberries, raspberries, blueberries, peaches, and pumpkins. Operates a U-pick season from mid-August through first fall freeze, with hayrides, field trips, and a pumpkin patch in the fall.

orchardu-pickapplesstone-fruit

Scimone's

📍 Concord, MA, 01742

in directory

Scimone's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Scuch Farms

📍 15565 State Route 536, Mount Vernon, 98273

in directory

Scuch Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

SCUSD Farmstand

📍 1055 Dunford Way, Sunnyvale, CA, 94087

in directory

SCUSD Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Seafood Market

📍 957 Howard Street, Evanston, 60202

in directory

Seafood Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Seasonal Berry Stand

in directory

Seasonal Berry Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Seasons' Yield Farm and Bakery

📍 167 Oakland Circle, Raphine, VA 24472 (Rockbridge County, near I-81 Exit 205)

in directory

A diverse organic family farm and wood-fired sourdough bakery in Raphine, Virginia (Rockbridge County, near Lexington, in the Shenandoah Valley at the foot of the Blue Ridge) — Fawn and Daniel Shear, founders. Twice-monthly farm-pickup 'Bread Days' (April–November) plus retail at Seasons Café in downtown Lexington and at Wildberry Market. Featured in *Condé Nast Traveler* and *Garden and Gun*. Founded during Daniel's military deployment to Afghanistan as an expression of family farming aspirations.

organic-farmwood-fired-bakerysourdoughfamily-farm

Second Star Farm

📍 New Castle, VA, 24127

in directory

Second Star Farm — a Certified Naturally Grown produce and flowers operation in New Castle, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Second Wind Perennial Farms

📍 Stony Point, NC, 28678

in directory

Second Wind Perennial Farms — a Certified Naturally Grown produce and flowers operation in Stony Point, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Secret Spring Farm Farmstand

in directory

Secret Spring Farm Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

See Canyon Fruit Ranch

in directory

See Canyon Fruit Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Seed Wise

📍 Country Club Hills, IL, 60478

in directory

Seed Wise — a Certified Naturally Grown produce and flowers operation in Country Club Hills, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Seeds Farm

in directory

Seeds Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sensenig Produce & Greenhouses

📍 1304 Elysburg Road, Danville, PA, 17821

in directory

Sensenig Produce & Greenhouses — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Sensenig's Produce & Flowers

in directory

Sensenig's Produce & Flowers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Serendipity Farm

📍 222 Cemetery Road, Quilcene, WA, 98376

in directory

Serendipity Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Seton Harvest

📍 Evansville, IN, 47720

in directory

Seton Harvest — a Certified Naturally Grown produce and flowers operation in Evansville, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Seven oaks

in directory

Seven oaks — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shades of Lavender Farm

📍 47222 24th Street, Mattawan, MI, 49071

in directory

Mattawan, Michigan lavender farm under family ownership since May 2021, run by a father-and-daughters team. Offers year-round farm visits, U-pick lavender in season, private and public classes, photography sessions, and a hammocking area among the rows.

herb-farmlavenderu-pickagritourism

Shady Creek Farm

📍 213 Kiser Dairy Road, Dallas, NC, 28034

in directory

Shady Creek Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Shady Mountain Market

📍 219 Dryville Road, Fleetwood, PA, 19522

in directory

Shady Mountain Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shaggy Coos Farm & Creamery

📍 53 Center Road, Easton, CT, 06612

in directory

A women-operated micro-dairy and meat farm at 53 Center Road in Easton, CT — Fairfield County, Connecticut. Established 2007. Bottles its own cream-line milk on-property and runs an honor-system farm store open 7 am – 7 pm, 7 days a week, 365 days a year. Stocks dairy, pastured pork, beef, poultry, turkey, and eggs from the farm; animals fed grass, hay, and grain that are antibiotic and hormone-free.

micro-dairycreamerycream-line-milkpastured-meat

Shalom Farms

📍 Midlothian, VA, 23113

in directory

Shalom Farms — a Certified Naturally Grown produce and flowers operation in Midlothian, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Shar-Nels Farmstand

📍 Philadelphia, 19123

in directory

Shar-Nels Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

SHARE Food Program

📍 2901 West Hunting Park Avenue, Philadelphia, 19129

in directory

SHARE Food Program — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Sharon Creek Farm

📍 East Gwillimbury, ON, L9N0G6

in directory

Sharon Creek Farm — a Certified Naturally Grown produce and flowers operation in East Gwillimbury, ON. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sharp's at Waterford Farm

📍 Brookeville, MD, 20833

in directory

Sharp's at Waterford Farm — a Certified Naturally Grown produce and flowers operation in Brookeville, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sharp's Farm

📍 4003 Jennings Chapel Road

in directory

Sharp's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shaul Farms Road Stand

in directory

Shaul Farms Road Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shea Kennedy

in directory

Shea Kennedy — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shelton's Farmstand

in directory

Shelton's Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shenot's Farm & Market

📍 3754 Wexford Run Road, Wexford, PA, 15090

in directory

Shenot's Farm & Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shepard Farms

in directory

Shepard Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shields Date Garden

📍 80225 Highway 111, Indio, 92201

in directory

Operating since December 24, 1924 in the Coachella Valley. Grows and processes nine named date varieties — Abbada, Barhi, Deglet Noor, Halawi, Honey, Khadrawi, Medjool, Thoory, Zahidi — and produces Date Crystals and Date Sugar on-site.

orcharddate-palmheritage-operationcoachella-valley

ShilliangUm Organic Producers Cooperative Society Ltd

📍 Meghalaya, India

in directory

ShilliangUm Organic Producers Cooperative Society Ltd — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Shine Farms

📍 Mechanicsville, VA, 23111

in directory

Shine Farms — a Certified Naturally Grown produce and flowers operation in Mechanicsville, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Shine Organic Farms

📍 Marseilles, IL, 61341

in directory

Shine Organic Farms — a Certified Naturally Grown produce and flowers operation in Marseilles, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Shirttail Creek Farm

📍 4200 Randle Hill Road, Brenham, TX, 77833

in directory

Shirttail Creek Farm is a family-run regenerative livestock operation in Brenham, TX (Blackland Prairies). 100% grass-fed and -finished beef, pasture-raised chicken and pork, pastured eggs, managed under intensive grazing + cover cropping rotations. Ships nationwide; on-site agritourism bunkhouse.

livestock-farmregenerativegrass-fedgrass-finished

Sholan Farms

in directory

Sholan Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shoots and Spores

📍 Sparta, GA, 31087

in directory

Shoots and Spores — a Certified Naturally Grown mushrooms operation in Sparta, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Shumway Farms Farm Store

📍 2325 WY-241, Afton, WY, 83110

in directory

Shumway Farms Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Shute Pecan Company

📍 1475 Ross Clark Circle, Dothan, AL, 36301

in directory

Shute Pecan Company — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Siena Farms

📍 Farm: 100 Boston Post Road, Sudbury, MA 01776. Retail: 106 Waltham Street, South End, Boston + Boston Public Market counter (100 Hanover St).

in directory

A 50-acre family farm in Sudbury, MA — 21st operating year — growing 100+ varieties of vegetables, flowers, and mushrooms on protected farmland. Two Boston retail locations (South End storefront + Boston Public Market counter); a CSA model with weekly and flexible farm shares across Eastern Massachusetts and New York; restaurant supply to Ana Sortun's Oleana, Sarma, and Sofra — the cluster that defined contemporary Boston farm-to-table.

csasudburybostongreater-boston

SIKIM ORGANIC GROWER GROUP-SRIPATAM GAGYONG (SOM-II)

📍 Sikkim, India

in directory

SIKIM ORGANIC GROWER GROUP-SRIPATAM GAGYONG (SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIIM ORGANIC GROWER GROUP-NEYA MANGZING 1(SOM-II)

📍 Sikkim, India

in directory

SIKKIIM ORGANIC GROWER GROUP-NEYA MANGZING 1(SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM DST ORGANIC GROWER GROUP - SOUTH

📍 Sikkim, India

in directory

SIKKIM DST ORGANIC GROWER GROUP - SOUTH — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM DST ORGANIC GROWER GROUP - WEST

📍 Sikkim, India

in directory

SIKKIM DST ORGANIC GROWER GROUP - WEST — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM DST ORGANIC GROWER GROUP PHASE I (SOUTH SIKKIM)

📍 Sikkim, India

in directory

SIKKIM DST ORGANIC GROWER GROUP PHASE I (SOUTH SIKKIM) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM DST ORGANIC GROWER GROUP PHASE I (WEST SIKKIM)

📍 Sikkim, India

in directory

SIKKIM DST ORGANIC GROWER GROUP PHASE I (WEST SIKKIM) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC BURIAKHOP GROWERS GROUP

📍 Sikkim, India

in directory

SIKKIM ORGANIC BURIAKHOP GROWERS GROUP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC DODAK KARTHOK GROWERS GROUP

📍 Sikkim, India

in directory

SIKKIM ORGANIC DODAK KARTHOK GROWERS GROUP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - ARITHANG CHONGRANG

in directory

SIKKIM ORGANIC GROWER GROUP - ARITHANG CHONGRANG — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

SIKKIM ORGANIC GROWER GROUP - BERTHANG

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - BERTHANG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - BORONG PAMTHANG - (SOM-III)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - BORONG PAMTHANG - (SOM-III) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - CHINGTHANG

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - CHINGTHANG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - GEYZING-YANTEY

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - GEYZING-YANTEY — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - KARZI-NORKHOLA

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - KARZI-NORKHOLA — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - KITAM MANPUR MIKHOLA BOOMTAR RONG BUL (SOM-III)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - KITAM MANPUR MIKHOLA BOOMTAR RONG BUL (SOM-III) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - LABING GERETHANG

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - LABING GERETHANG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - LABING GERETHANG

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - LABING GERETHANG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - MAMLEY KAMRANG SALGHARI TINIK CHISOPANI (SOM-III)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - MAMLEY KAMRANG SALGHARI TINIK CHISOPANI (SOM-III) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - MANEY DARA & TURUNG MAMRING

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - MANEY DARA & TURUNG MAMRING — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - RHENOCK

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - RHENOCK — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - RINCHENPONG

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - RINCHENPONG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP - SANGANATH (SOM-III)

in directory

SIKKIM ORGANIC GROWER GROUP - SANGANATH (SOM-III) — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

SIKKIM ORGANIC GROWER GROUP - YANGANG RANGANG BENNAMPHRIK RABONG SANGMO - (SOM-III)

in directory

SIKKIM ORGANIC GROWER GROUP - YANGANG RANGANG BENNAMPHRIK RABONG SANGMO - (SOM-III) — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

SIKKIM ORGANIC GROWER GROUP - YANGTHANG

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP - YANGTHANG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP -RAMENG-NIZ RAMENG &PHONGLA

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP -RAMENG-NIZ RAMENG &PHONGLA — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP -YANGANG-RANGANG & BENNAMPRIK

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP -YANGANG-RANGANG & BENNAMPRIK — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP LINGEE TINKITAM [ MANAGED BY : SIKKIM ORGANIC MISSION ]

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP LINGEE TINKITAM [ MANAGED BY : SIKKIM ORGANIC MISSION ] — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- BARFUNG JARRONG (SOM-III)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- BARFUNG JARRONG (SOM-III) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- BERMIOK TOKAL (SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- BERMIOK TOKAL (SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- DAMTHANG JAUBARI & TINGRITHANG (SOM-III)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- DAMTHANG JAUBARI & TINGRITHANG (SOM-III) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- KARMATAR GEYTANG

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- KARMATAR GEYTANG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- KATENG PAMPHOK NAGIKAREK MANEYDARA TURUNG MAMRING (SOM-III)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- KATENG PAMPHOK NAGIKAREK MANEYDARA TURUNG MAMRING (SOM-III) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- LUNGCHUK KAMEREY & SUMBUK KARTIKEY (SOM-III)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- LUNGCHUK KAMEREY & SUMBUK KARTIKEY (SOM-III) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- MANEYBUNG SOPKHA

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- MANEYBUNG SOPKHA — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- MELLI ACHING, THINGLING KHECHEPERI

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- MELLI ACHING, THINGLING KHECHEPERI — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- RALONG NAMLUNG LAMATEN TINGMOO & LEGSHIP (SOM-III)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- RALONG NAMLUNG LAMATEN TINGMOO & LEGSHIP (SOM-III) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- RUMBUK

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- RUMBUK — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- TANZI BIKMAT

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- TANZI BIKMAT — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- TURUK RAMABONG & MELLIDARA PAYONG

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- TURUK RAMABONG & MELLIDARA PAYONG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP- TURUK RAMABONG & MELLIDARA PAYONG

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP- TURUK RAMABONG & MELLIDARA PAYONG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-GYALSHING

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-GYALSHING — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-KEWZING-BAKHIM (SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-KEWZING-BAKHIM (SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-LAMATEN TINGMOO (SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-LAMATEN TINGMOO (SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-LARGE CARDAMOM SOM PHASE-I AND II-SOUTH

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-LARGE CARDAMOM SOM PHASE-I AND II-SOUTH — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-LARGE CARDAMOM SOM PHASE-III SOUTH SIKKIM

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-LARGE CARDAMOM SOM PHASE-III SOUTH SIKKIM — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-LINGEE (SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-LINGEE (SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-LINGMOO KOLTHANG(SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-LINGMOO KOLTHANG(SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-LINGMOO KOLTHANG(SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-LINGMOO KOLTHANG(SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-NAGI-PHAMPHOK

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-NAGI-PHAMPHOK — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-NEYA MANGZING 2(SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-NEYA MANGZING 2(SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-PAIYONG(SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-PAIYONG(SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-RATEYPANI

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-RATEYPANI — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-RATEYPANI

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-RATEYPANI — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-SADAM SUNTALEY

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-SADAM SUNTALEY — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-SOROK-SHYAMPANI (SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-SOROK-SHYAMPANI (SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-TARKU(SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-TARKU(SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-TEMI (SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-TEMI (SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-TINKITAM RAYONG(SOM-II)

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-TINKITAM RAYONG(SOM-II) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-WOK-OMCHU (SOM-II )

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-WOK-OMCHU (SOM-II ) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWER GROUP-YANGANG-RAVANG-SANGMO

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWER GROUP-YANGANG-RAVANG-SANGMO — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWERS GROUP HEE-PETCHREK

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWERS GROUP HEE-PETCHREK — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC GROWERS GROUP OF LARGE CARDAMOM-TASHIDING, YUKSOM

📍 Sikkim, India

in directory

SIKKIM ORGANIC GROWERS GROUP OF LARGE CARDAMOM-TASHIDING, YUKSOM — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

Sikkim Organic Large Cardamom Grower Group - Barasamdong-Chota Samdong

📍 Sikkim, India

in directory

Sikkim Organic Large Cardamom Grower Group - Barasamdong-Chota Samdong — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

Sikkim Organic Large Cardamom Grower Group - Deythang Mendogaon

📍 Sikkim, India

in directory

Sikkim Organic Large Cardamom Grower Group - Deythang Mendogaon — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP CHINGTHANG BERMIOK RADHU KHANDU

📍 Sikkim, India

in directory

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP CHINGTHANG BERMIOK RADHU KHANDU — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP DODAK BURIAKHOP RINCHENPONG

📍 Sikkim, India

in directory

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP DODAK BURIAKHOP RINCHENPONG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP LINGEE TINKITAM

📍 Sikkim, India

in directory

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP LINGEE TINKITAM — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP- MELLI ACHING

📍 Sikkim, India

in directory

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP- MELLI ACHING — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP- NAMBU DARAP

📍 Sikkim, India

in directory

SIKKIM ORGANIC LARGE CARDAMOM GROWER GROUP- NAMBU DARAP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC MARTAM, PECHREK, HEE, DENTAM LARGE CARDAMOM GROWERS GROUP

📍 Sikkim, India

in directory

SIKKIM ORGANIC MARTAM, PECHREK, HEE, DENTAM LARGE CARDAMOM GROWERS GROUP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC MISSION - HATHIDUNGA - JEEL BOOM

in directory

SIKKIM ORGANIC MISSION - HATHIDUNGA - JEEL BOOM — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

SIKKIM ORGANIC MISSION LARGE CARDAMOM GROWER GROUP-SINGYANG CHUMBONG

📍 Sikkim, India

in directory

SIKKIM ORGANIC MISSION LARGE CARDAMOM GROWER GROUP-SINGYANG CHUMBONG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC MISSION- CHUBA & PERBING

in directory

SIKKIM ORGANIC MISSION- CHUBA & PERBING — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

SIKKIM ORGANIC MISSION- KHANISERBONG, SULDUNG-KAMLING, CHAKUNG

📍 Sikkim, India

in directory

SIKKIM ORGANIC MISSION- KHANISERBONG, SULDUNG-KAMLING, CHAKUNG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC MISSION-BUDANG-KARTHOK-GELLING SAMSING

in directory

SIKKIM ORGANIC MISSION-BUDANG-KARTHOK-GELLING SAMSING — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

SIKKIM ORGANIC MISSION: DEYTHANG/38/37/39/42,WEST SIKKIM

📍 Sikkim, India

in directory

SIKKIM ORGANIC MISSION: DEYTHANG/38/37/39/42,WEST SIKKIM — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC MISSION: GELLING SAMSING/34/35,WEST SIKKIM

📍 Sikkim, India

in directory

SIKKIM ORGANIC MISSION: GELLING SAMSING/34/35,WEST SIKKIM — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC MISSION: TAKUTHANG/27/29/32/33,WEST SIKKIM

📍 Sikkim, India

in directory

SIKKIM ORGANIC MISSION: TAKUTHANG/27/29/32/33,WEST SIKKIM — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC RADHU KHANDU GROWER GROUP

📍 Sikkim, India

in directory

SIKKIM ORGANIC RADHU KHANDU GROWER GROUP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC RADHU KHANDU-BERMOIK GROWER GROUP

📍 Sikkim, India

in directory

SIKKIM ORGANIC RADHU KHANDU-BERMOIK GROWER GROUP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC, SINGLING BERMOIK GROWERS GROUP

📍 Sikkim, India

in directory

SIKKIM ORGANIC, SINGLING BERMOIK GROWERS GROUP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC, SINGLING BERMOIK GROWERS GROUP

📍 Sikkim, India

in directory

SIKKIM ORGANIC, SINGLING BERMOIK GROWERS GROUP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC, SORENG MALBASEY GROWERS GROUP

📍 Sikkim, India

in directory

SIKKIM ORGANIC, SORENG MALBASEY GROWERS GROUP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKIM ORGANIC, TIMBURBUNG THARPU GROWERS GROUP

in directory

SIKKIM ORGANIC, TIMBURBUNG THARPU GROWERS GROUP — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

SIKKIM ORGANIC, ZOOM CHUMBUNG GROWERS GROUP

📍 Sikkim, India

in directory

SIKKIM ORGANIC, ZOOM CHUMBUNG GROWERS GROUP — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKKINM ORGANIC GROWER GROUP - SINGYANG

📍 Sikkim, India

in directory

SIKKINM ORGANIC GROWER GROUP - SINGYANG — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

SIKTAM TIKPUR SOMBAREY GROWER GROUP (SBOR13SKWSSS)

📍 Sikkim, India

in directory

SIKTAM TIKPUR SOMBAREY GROWER GROUP (SBOR13SKWSSS) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

Silly Goose Acres, LLC

📍 Plainwell, MI, 49080

in directory

Silly Goose Acres, LLC — a Certified Naturally Grown livestock operation in Plainwell, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Silver Bell Farm

📍 305 Silver Street, Monson, MA

in directory

Silver Bell Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

Silver Spring Farm Market

in directory

Silver Spring Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Silverman's Farm

in directory

Silverman's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Simmons Farm

📍 2859 Washington Road, McMurray, PA, 15317

in directory

A fruit, vegetable, and flower farm in the south hills of Pittsburgh — McMurray, Washington County, PA. Two retail locations: the working farm at 170 Simmons Road and the Rt. 19 market at 2861 Washington Road. U-pick apples, peaches, strawberries, flowers, and pumpkins; on-site greenhouse production; hayrides, petting zoo, birthday parties, summer camps, and field trips. Seasonal arc Easter through Christmas.

orchardu-pickapplespeaches

Simon's Hancock Farms & Greenhouses

in directory

Simon's Hancock Farms & Greenhouses — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Simple Gifts Farm

📍 1089 North Pleasant Street, Amherst, MA

in directory

Simple Gifts Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Simply Fresh Market

in directory

Simply Fresh Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sin City Feed

📍 2461 East Deerskin Street, 89048

in directory

Sin City Feed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sinder's Tree Farm

in directory

Sinder's Tree Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

Singing Frogs Farm

3 ac

📍 Sebastopol, California, USA (Sonoma County)

in directory

A 3-acre Northern California vegetable farm grossing over $100,000 per acre through a no-till, biologically-intensive system — roughly 7× the regional average. The case study cited when arguing that small-scale ecological farming can be radically more productive than industrial agriculture.

regenerativeno-tillvegetablescalifornia

Singing Nettle Farm

📍 Palmer, AK, 99645

in directory

Singing Nettle Farm — a Certified Naturally Grown produce and flowers operation in Palmer, AK. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Singing Trees Farm

📍 LaFarge, WI, 54639

in directory

Singing Trees Farm — a Certified Naturally Grown produce and flowers operation in LaFarge, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Siskiyou Herefords & Angus

in directory

Siskiyou Herefords & Angus — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Sissiboo Organics

📍 Bear River, NS, B0S1B0

in directory

Sissiboo Organics — a Certified Naturally Grown produce and flowers operation in Bear River, NS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Skagit Maid

in directory

Skagit Maid — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Skelly's Farm Market

📍 2713 South Hayner Road, Janesville, WI, 53548

in directory

Skelly's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Ski-Hi Fruit Farm

📍 E11219A Ski Hi Road, Baraboo, WI, 53913

in directory

Ski-Hi Fruit Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sky Ridge Farm and Kitchen

📍 Middleburgh, NY, 12122

in directory

Sky Ridge Farm and Kitchen — a Certified Naturally Grown produce and flowers operation in Middleburgh, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Slate Hill Farm & Market

📍 8737 Ashfield Road, Slatington, PA, 18080

in directory

Slate Hill Farm & Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Slattengren Farms

📍 28776 Saint Croix Trail, Shafer, MN, 55074

in directory

Five-generation Minnesota maple operation on the Saint Croix Trail in Shafer. Boils sap from local maples on-site into pure syrup plus barrel-aged and infused varieties (bourbon, black walnut, lavender, hot pepper). Farm shop carries scratch-baked goods and ice cream from a nearby Forest Lake dairy.

maple-sugarbushmulti-generationalfive-generationslocal-sourcing

Slide Rock Market

in directory

Slide Rock Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Slowpoke Farm

📍 Richmond, VA, 23231

in directory

Slowpoke Farm — a Certified Naturally Grown produce and flowers operation in Richmond, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Small Farm

in directory

Small Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Small Farmz

📍 Ellenwood, GA, 30294

in directory

Small Farmz — a Certified Naturally Grown produce and flowers operation in Ellenwood, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Smicksburgh Produce Auction

in directory

Smicksburgh Produce Auction — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Smiley's Red Barn

in directory

Smiley's Red Barn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Smith Family Ranch

📍 Milanville, Pennsylvania (Wayne County)

in directory

A family-operated ranch in Milanville, Pennsylvania (Wayne County), on the Upper Delaware River, producing grass-fed beef and pasture-raised pork. One of several Wayne County small-livestock operations using rotational grazing and direct-to-consumer sales to remain viable on commodity-meat economics that have collapsed for most peers.

grass-fedbeefporkfamily-ranch

Smith's Farms

in directory

Smith's Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Smyly Farms

📍 Chattahoochee Hills, GA, 30268

in directory

Smyly Farms — a Certified Naturally Grown livestock operation in Chattahoochee Hills, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Snell Family Farm

in directory

Snell Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Sobieski's River Valley Farm

📍 01093

in directory

Sobieski's River Valley Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sogn Valley Orchard

in directory

Sogn Valley Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Soil Born Farms

in directory

Soil Born Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sojourn farm

in directory

Sojourn farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

SolFed Farm

📍 Duluth, MN, 55804

in directory

SolFed Farm — a Certified Naturally Grown produce and flowers operation in Duluth, MN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Solid Ground Farm

📍 285 Tongore Road, Kingston, 12401

in directory

Solid Ground Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Solly Brothers Farm

in directory

Solly Brothers Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Sommerset Farm

in directory

Sommerset Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sonder Farmstead

📍 Deming, WA, 98244

in directory

Sonder Farmstead — a Certified Naturally Grown produce and flowers operation in Deming, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sonrise Farm

in directory

Sonrise Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Soons Orchards

📍 23 Soons Circle, New Hampton, NY, 10958

in directory

Soons Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Soul Fire Farm

📍 Soul Fire Farm — 1972 NY-2, Petersburg, New York 12138 (Rensselaer County)

in directory

An 80-acre Afro-Indigenous-centered community farm in Petersburg, NY — co-founded 2010 by Leah Penniman, Jonah Vitale-Wolff, and Naima Penniman. Mission: 'ending racism and injustice in the food system.' Reaches 60,000+ people annually through farmer training for Black and Brown growers, reparations and land-return initiatives, food-justice workshops for urban youth, doorstep harvest delivery for food-insecure households, and systems-and-policy education. The principal Black-led food-sovereignty institution in the Hudson watershed.

food-sovereigntyblack-ledafro-indigenousfood-justice

Sound Shore Market

📍 5629 Sound Avenue, Riverhead, NY, 11901

in directory

Sound Shore Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

SOURCE NATURAL FOODS AND HERBAL SUPPLEMENTS LIMITED

📍 Telangana, India

in directory

SOURCE NATURAL FOODS AND HERBAL SUPPLEMENTS LIMITED — an NPOP-certified organic operator in Telangana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatelangana

SOURCE NATURAL FOODS AND HERBAL SUPPLEMENTS LIMITED

📍 Telangana, India

in directory

SOURCE NATURAL FOODS AND HERBAL SUPPLEMENTS LIMITED — an NPOP-certified organic operator in Telangana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatelangana

South Forty Farm

📍 Lake Wylie, 29710

in directory

South Forty Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

South Milford Grain Elevator

in directory

South Milford Grain Elevator — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedgrain-farm

South Tampa Farm

in directory

South Tampa Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

South Tyger Market

in directory

South Tyger Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

South West Garlic Co.

📍 Seminole, TX, 79360

in directory

South West Garlic Co. — a Certified Naturally Grown produce and flowers operation in Seminole, TX. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Southern Agriculture

in directory

Southern Agriculture — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Southern Pine Farm

📍 Greensboro, GA, 30642

in directory

Southern Pine Farm — a Certified Naturally Grown produce and flowers operation in Greensboro, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Southern Produce Distribution Inc

📍 8957 NC-96, Benson, NC, 27504

in directory

Southern Produce Distribution Inc — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Southside Produce Co.

in directory

Southside Produce Co. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Southwind Orchards

in directory

Southwind Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Spaces of Opportunity

📍 South Phoenix, AZ

in directory

Spaces of Opportunity is a South Phoenix 501(c)(3) nonprofit transforming 19 acres in a Sonoran-Desert food-insecure neighborhood into a community-agriculture hub. Three programs: incubator farms (10,000-sq-ft plots for emerging commercial farmers), community garden plots, and a neighborhood farmers market.

vegetable-farmnonprofiturban-agricultureincubator-farm

Spear's Farmstand

📍 1520 Atlantic Highway, Waldoboro, ME, 04572

in directory

Spear's Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Spencer Farm

📍 7177 East 161st Street, Noblesville, IN, 46062

in directory

An Indiana farm in Noblesville running two distinct operations on the same property: a berry farm with you-pick fields and farm market, and a vineyard + winery housed in a restored 1883 farmhouse that opened as a working winery in October 2019. The vineyard sits in an outdoor event space among the vines.

vineyardberry-farmwineryhistoric-farmhouse

Spice Acres

📍 9557 Riverview Road, Brecksville, 44141

in directory

Spice Acres — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Spice Creek Enterprise

📍 Brandywine, MD, 20613

in directory

Spice Creek Enterprise — a Certified Naturally Grown produce and flowers operation in Brandywine, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Spina Farms

📍 800 Laguna Avenue, San Jose, 95037

in directory

Spina Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Splendid Earth Farm

📍 Berlin, MD, 21811

in directory

Splendid Earth Farm — a Certified Naturally Grown produce and flowers operation in Berlin, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Spooners Farms

in directory

Spooners Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Spring Brook Farm

📍 591 Great Road

in directory

Same-family farm in Littleton, MA, with over 300 years on the same ground. Farm-raised meats, field-picked produce, and a 'Freedom Shares' CSA — a $275 coupon book that returns $300 in farm goods redeemable on the customer's own schedule.

vegetable-farmmulti-generationalcsaheritage-operation

Spring Haven Farm

in directory

Spring Haven Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Spring Ledge Farm

📍 37 Main Street, New London, NH, 03257

in directory

A diversified small farm at 37 Main Street in New London, New Hampshire, growing cut flowers, ornamental plants, vegetables, and fruit on the same operation. Runs a seasonal farmstand, a flower-share CSA, and pick-your-own seasons for both flowers and strawberries. Uses Integrated Pest Management across field and greenhouse production.

flower-farmvegetable-farmcsau-pick

Spring Rose Farm Market

in directory

Spring Rose Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Spring Valley Farm Market

📍 2454 Northwestern Pike, Winchester, VA

in directory

Spring Valley Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Springdale Farms

📍 1638 Springdale Road, Cherry Hill, NJ, 08003

in directory

Springdale Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Spruill Conservation Farm

📍 Roper, NC, 27970

in directory

Spruill Conservation Farm — a Certified Naturally Grown produce and flowers operation in Roper, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

SRI ANANDATEERTHA AROMATICS PRIVATE LIMITED

📍 Karnataka, India

in directory

SRI ANANDATEERTHA AROMATICS PRIVATE LIMITED — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

SRI ANANDATEERTHA AROMATICS PRIVATE LIMITED

📍 Uttar Pradesh, India

in directory

SRI ANANDATEERTHA AROMATICS PRIVATE LIMITED — an NPOP-certified organic operator in Uttar Pradesh, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiauttar-pradesh

SRISTI BIO SCIENCES PRIVATE LIMITED

📍 Telangana, India

in directory

SRISTI BIO SCIENCES PRIVATE LIMITED — an NPOP-certified organic operator in Telangana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatelangana

Srybny Farmstand and Greenhouses

in directory

Srybny Farmstand and Greenhouses — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Stade's Farm

📍 3709 Miller Road, McHenry, IL, 60051

in directory

Stade's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Staehly Farms

in directory

Staehly Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Stage 22 Farms

📍 280 River Road, Marietta, SC, 29661

in directory

Stage 22 Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Stagecoach Farms

in directory

Stagecoach Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Stan's Market

in directory

Stan's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Standard Bushel

📍 5903 South Highway 27, Somerset, KY, 42501-6089

in directory

Standard Bushel — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Star View Farm

📍 622 S County Rd, Berthoud, CO, 80513

in directory

Family-run livestock operation along Colorado's Front Range, 30+ years in. Raises Australian Lowline and British White cattle 100% grass-fed and grass-finished, Berkshire swine, pastured poultry, lamb, and honey from on-farm hives.

livestock-farmapiarygrass-fedfamily-owned

Starseed Ranch

📍 52-4700 Akoni Pule Highway

in directory

Starseed Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

STATE SEED FARM ALUVA

📍 Kerala, India

in directory

STATE SEED FARM ALUVA — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Steel Wheel Farm, LLC

📍 Fall City, WA, 98024

in directory

Steel Wheel Farm, LLC — a Certified Naturally Grown produce and flowers operation in Fall City, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Stellitado Farm

in directory

Stellitado Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Steptoe Farm

📍 Brandywine, MD, 20613

in directory

Steptoe Farm — a Certified Naturally Grown produce and flowers operation in Brandywine, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Stere Farm Orchard

in directory

Stere Farm Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Sterling Dairy

📍 9760 District Line Road, Burlington, 98233

in directory

Sterling Dairy — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Stetson Creek Apple Ranch

in directory

Stetson Creek Apple Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Steve's Farm

in directory

Steve's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sticky Bottom Produce Company

📍 58343 North Carolina Highway 12, Hatteras, NC, 27943

in directory

Sticky Bottom Produce Company — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Stillwind Farm LLC

📍 Muskegon Heights, MI, 49444

in directory

Stillwind Farm LLC — a Certified Naturally Grown produce and flowers operation in Muskegon Heights, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Stine Orchard Shop

📍 1823 Monkton Road, Monkton, VT

in directory

Stine Orchard Shop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Stone Barns Center for Food and Agriculture

80 ac

📍 Pocantico Hills, New York, USA

in directory

An 80-acre nonprofit farm + research + education center north of New York City — built as a memorial to Peggy Rockefeller and operated alongside Dan Barber's two-Michelin-star Blue Hill restaurant. The institutional model for marrying working farm, scientific research, and culinary excellence.

regenerativeeducationnonprofitnew-york

Stone Brook Hill Farm

in directory

Stone Brook Hill Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Stone Tree Farms

in directory

Stone Tree Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Stoneback Farms

in directory

Stoneback Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Stonewall Farm

in directory

Stonewall Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Stony Grove

📍 1286 Pratt Road, Jeffersonville, VT, 05464

in directory

Jeffersonville, Vermont orchard with 40+ apple varieties, blueberries, haskap, and lavender — using integrated pest management since the first marketable harvest in 2019.

orchardipmapple-diversitylavender

Stonynook Farm

in directory

Stonynook Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Storm Farms

📍 3010 South Bowen Road, Arlington, TX, 76016

in directory

Storm Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Stoughton Farm

📍 10898 State Route 38, 13811

in directory

Stoughton Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Stovers Farm Market & U-pic

📍 7837 M-139, Berrien Springs, MI, 49103

in directory

A working orchard and farm market in Berrien Springs, Michigan, in the southwestern corner of the state — peaches, cherries, apples, and other tree fruit, with U-pick alongside the farmstand. Runs a substantial value-add product line (peach / cherry / black-bean-corn salsas, Sweet Fire pickles, dried cherries, applesauce, jarred peach halves) plus a Red Barn event venue and school-trip programming.

orchardberry-farmu-pickvalue-add

Straw Hat Farm Market & Kitchen Store

📍 514 South 1st Street, CO

in directory

Straw Hat Farm Market & Kitchen Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Strawberry Acres

in directory

Strawberry Acres — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Strawberry Patch

in directory

Strawberry Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Strawberry Stand

in directory

Strawberry Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Stryker Farm

47 ac

📍 Saylorsburg / Wind Gap, Pennsylvania (Monroe / Northampton County edge); store at 67 Park Ave, Wind Gap, PA 18091

in directory

A 47-acre pasture-based livestock farm in the Pocono Mountains region of Pennsylvania (Saylorsburg / Wind Gap area, Monroe-Northampton County edge), founded 2011. Raises grass-fed beef, pastured pork, sheep, and poultry without antibiotics, hormones, or GMOs. Sells through their farm store at 67 Park Ave in Wind Gap, online direct, wholesale, and through pig-roast catering. One of the bioregion's clearest demonstrations that the Polyface-style multi-species pasture-livestock model can scale on Pocono-edge ground.

pasture-livestockbeefporksheep

Stuckey Farm Market

📍 19975 North 1200 East, Sheridan, IN, 46069

in directory

Stuckey Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Studio Hill

📍 957 Trumbull Hill Road, Shaftsbury, VT, 05262

in directory

Studio Hill is a 90-year (since 1936) family farm in Shaftsbury, VT, specializing in 100% grass-fed Katahdin sheep (200+ head) managed under holistic land-restoration principles. Accredited Savory Institute Hub and Training Center since 2023; offers ecological-restoration courses and farm stays.

livestock-farmsheepkatahdingrass-fed

Stults Farmstand

in directory

Stults Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Stutzman Farms

📍 6197 Township Road 605, 44654

in directory

Stutzman Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sugar Butte Farms

📍 648 Schau Road, Lowell, OH

in directory

Sugar Butte Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sujecki Farms & Nurseries

📍 758 Edwards Avenue, Calverton, NY, 11933

in directory

Sujecki Farms & Nurseries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Summertime Sno

in directory

Summertime Sno — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sun Love Farm

📍 Oregon City, OR, 97045

in directory

Sun Love Farm — a Certified Naturally Grown produce and flowers operation in Oregon City, OR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sun Spoke Farms

📍 Amherst, VA, 24521

in directory

Sun Spoke Farms — a Certified Naturally Grown produce and flowers operation in Amherst, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sundance Farm

📍 Danielsville, GA, 30633

in directory

Sundance Farm — a Certified Naturally Grown produce and flowers operation in Danielsville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sunflower Stand

in directory

Sunflower Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Sunfrost Farms

📍 217 Tinker Street, Woodstock, NY, 12498

in directory

Sunfrost Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sunny Acres Farms

📍 Fayetteville, AR, 72703

in directory

Sunny Acres Farms — a Certified Naturally Grown produce and flowers operation in Fayetteville, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sunny Cove Farm

📍 1444 Randolph Road, Alfred Station, NY, 14803

in directory

Sunny Cove Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Sunny Hill Growers LLC

📍 Rocky Ridge, MD, 21778

in directory

Sunny Hill Growers LLC — a Certified Naturally Grown produce and flowers operation in Rocky Ridge, MD. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sunny Slope Farms

in directory

Sunny Slope Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sunnycrest Farm

📍 59 High Range Road, Londonderry, 03053

in directory

Sunnycrest Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Sunnyfield Farm

in directory

Sunnyfield Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sunnyside Farm

📍 Corryton, TN, 37721

in directory

Sunnyside Farm — a Certified Naturally Grown produce and flowers operation in Corryton, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sunrise Farms Nursery LLC

📍 Darien, WI, 53114

in directory

Sunrise Farms Nursery LLC — a Certified Naturally Grown produce and flowers operation in Darien, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sunrise Nursery

📍 Winterville, GA, 30607

in directory

Sunrise Nursery — a Certified Naturally Grown produce and flowers operation in Winterville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sunrise Orchards

📍 Gays Mills, WI (Crawford County)

in directory

Family-operated apple orchard in Gays Mills — the apple capital of Wisconsin — at the western edge of the Driftless Area. Operating since the early 1900s on Crawford County coulee terrain that the apple industry recognized as some of the best apple-growing ground in the upper Midwest. Today: 50,000+ trees across multiple orchards, 30+ varieties, packing operations supplying regional grocery, an on-site farm market, and a fall pick-your-own season that draws visitors from across the upper Midwest. A working substrate-builder anchor for the Driftless directory cluster.

orcharddriftlesswisconsinsubstrate-builder

Sunset Farm

in directory

Sunset Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sunset View Farm

📍 156 Gardner Road, Winchendon, MA, 01475

in directory

Sunset View Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sunshine Farm

📍 Monroe, GA, 30656

in directory

Sunshine Farm — a Certified Naturally Grown produce and flowers operation in Monroe, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Sunshine Farm Shop

in directory

Sunshine Farm Shop — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sunshine Herb & Lavender Farm

in directory

Sunshine Herb & Lavender Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

SUNTARA COSMETICS PRIVATE LIMITED

📍 Gujarat, India

in directory

SUNTARA COSMETICS PRIVATE LIMITED — an NPOP-certified organic operator in Gujarat, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiagujarat

Super Coco Company

📍 Tamil Nadu, India

in directory

Super Coco Company — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

SUPERVEDIC VENTURE LLP

📍 Gujarat, India

in directory

SUPERVEDIC VENTURE LLP — an NPOP-certified organic operator in Gujarat, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiagujarat

Suyametsu and Bentryn Family Farms

in directory

Suyametsu and Bentryn Family Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Swamp Rabbit Grocery

📍 205 Cedar Lane Road, Greenville, SC, 29611

in directory

Swamp Rabbit Grocery — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Swanson Farm

in directory

Swanson Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Swanton Berry Farm

in directory

Swanton Berry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Sweet Beginnings

📍 Chicago, IL, 60302

in directory

Sweet Beginnings — a Certified Naturally Grown apiary operation in Chicago, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Sweet Corn

in directory

Sweet Corn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Sweet Creek

in directory

Sweet Creek — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sweet Roots Farm and Garden

in directory

Sweet Roots Farm and Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Sweetland Farm

📍 742 Route 132, Norwich, VT, 05055

in directory

Sweetland Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Sweetser's Apple Barrel

📍 19 Blanchard Road, Cumberland Center, ME, 04021

in directory

Sweetser's Apple Barrel — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Swift Creek Berry Farm Incorporated

📍 Moseley, VA, 23120

in directory

Swift Creek Berry Farm Incorporated — a Certified Naturally Grown produce and flowers operation in Moseley, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Swimming Buck Farm

📍 Horton, AL, 35980

in directory

Swimming Buck Farm — a Certified Naturally Grown produce and flowers operation in Horton, AL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

SYAM JAIVIK UTPADAK SAMITI 4 KSR

📍 Rajasthan, India

in directory

SYAM JAIVIK UTPADAK SAMITI 4 KSR — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

T J's Mountain Market

📍 607 Carl Eller Road, Mars Hill, NC, 28754

in directory

T J's Mountain Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

T S Smith & Sons

📍 8887 Redden Road, Bridgeville, DE, 19933

in directory

T S Smith & Sons — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

T.S. Smith Orchard Point Market

📍 9045 Redden Road, Bridgeville, DE, 19933

in directory

T.S. Smith Orchard Point Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Taber's Orchard

in directory

Taber's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

TableTop Farms

📍 Chillicothe, MO, 64601

in directory

TableTop Farms — a Certified Naturally Grown produce and flowers operation in Chillicothe, MO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Tagge's Famous Fruit & Veggie Farms

📍 3431 South Highway 89, Perry City, UT, 84302-4210

in directory

150-acre family farm in Perry, Utah, operating since 1977. Runs a 15-week summer CSA (Tagge Farm Box, July–mid-October), seasonal stands across the Wasatch Front, and a Salt Lake City warehouse coordinating year-round Wasatch farmers-market distribution.

vegetable-farmberry-farmcsawasatch-front

Taglieri Orchard

📍 4815 Zeiglers Church Road, Spring Grove, PA, 17362

in directory

Taglieri Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Tangled Thicket Farm

📍 Mount Vernon, WA, 98274

in directory

Tangled Thicket Farm — a Certified Naturally Grown produce and flowers operation in Mount Vernon, WA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Tap Root Tree Farm

in directory

Tap Root Tree Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

Tapia Brothers Inc.

in directory

Tapia Brothers Inc. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Tarbox Farms

📍 1533 State Route 7, Troy, NY, 12180

in directory

Tarbox Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Tarheel Too

in directory

Tarheel Too — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Tart's Strawberry and Produce LLC

📍 100 North Powell Avenue, Dunn, NC, 28334

in directory

Tart's Strawberry and Produce LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

TASTY NUT INDUSTRIES

📍 Kerala, India

in directory

TASTY NUT INDUSTRIES — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Tater Sack

📍 5283 US Highway 25-70

in directory

Tater Sack — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Taylor Farm Cheese

📍 825 State Route 11, Londonderry, VT, 05148

in directory

Taylor Farm Cheese — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Taylor Farms

📍 4865 Alabama Highway 113, Flomaton, AL, 36441

in directory

Taylor Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

TBOF Foods Private Limited

📍 Maharashtra, India

in directory

TBOF Foods Private Limited — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

TCP ORGANICS PRIVATE LIMITED

📍 Delhi, India

in directory

TCP ORGANICS PRIVATE LIMITED — an NPOP-certified organic operator in Delhi, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiadelhi

TEA EXPERTS INDIA PRIVATE LIMITED

📍 West Bengal, India

in directory

TEA EXPERTS INDIA PRIVATE LIMITED — an NPOP-certified organic operator in West Bengal, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiawest-bengal

TEA EXPERTS INDIA PRIVATE LIMITED

📍 West Bengal, India

in directory

TEA EXPERTS INDIA PRIVATE LIMITED — an NPOP-certified organic operator in West Bengal, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiawest-bengal

Teacher's Farm

📍 Rutherfordton, NC, 28139

in directory

Teacher's Farm — a Certified Naturally Grown produce and flowers operation in Rutherfordton, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

TEMI TEA ESTATE

📍 Sikkim, India

in directory

TEMI TEA ESTATE — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

Temi Tea Estate Factory

📍 Sikkim, India

in directory

Temi Tea Estate Factory — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

Tendercrop Farm

📍 110 High Road, Newbury, MA

in directory

Tendercrop Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Tendercrop Farm at the Red barn

in directory

Tendercrop Farm at the Red barn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Tennessee Premium Beef

📍 133 Munford-Atoka Avenue, 38058

in directory

Tennessee Premium Beef — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Terra Vita Farm

📍 Castle Hayne, NC, 28429

in directory

Terra Vita Farm — a Certified Naturally Grown produce and flowers operation in Castle Hayne, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Terrace Farm

📍 171 Main Street, Phoenicia, 12464

in directory

Terrace Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Tewes Farm

📍 2801 Crescent Springs Pike, Erlanger, KY, 41018

in directory

A family poultry farm in Erlanger, Kentucky, just south of the Ohio River and Cincinnati. Raises chickens year-round for eggs and meat, plus a holiday-season dressed turkey program (orders open November 1). Sells fresh — the operating principle is freshness without thawing — direct in the Northern Kentucky / Tri-State region.

poultry-farmfamily-farmfresh-not-frozenohio-river-valley

Thadlaskein Organic Producers Cooperative Society Ltd. (Group I)

📍 Meghalaya, India

in directory

Thadlaskein Organic Producers Cooperative Society Ltd. (Group I) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

Thadlaskein Organic Producers Cooperative Society Ltd. (Group II)

📍 Meghalaya, India

in directory

Thadlaskein Organic Producers Cooperative Society Ltd. (Group II) — an NPOP-certified organic operator in Meghalaya, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiameghalaya

The Agora

📍 6112 Hixson Pike, Hixson, TN

in directory

The Agora — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Apple Barrel

📍 6344 Orchard View Drive Southeast, East Canton, OH, 44730

in directory

The Apple Barrel — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

The Apple Farm

📍 18501 Philo Greenwood Road

in directory

The Apple Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

The Berry Patch

in directory

The Berry Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

The Big Apple

in directory

The Big Apple — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

The Big Red Apple Shed

📍 594 TN-126, Bristol, TN, 37620

in directory

The Big Red Apple Shed — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

The Classy Cow Farmstand

📍 36042 Riverside Drive Southwest, Albany, OR, 97321

in directory

Willamette Valley family dairy (founded 2010) selling Jersey-cow creamline milk, 100% grass-finished beef, all-natural pork, and free-range eggs — no added hormones or antibiotics across products. Named 2026 Oregon Dairy Industries State Winner for Fresh Milk.

dairylivestock-farmgrass-finishedcreamline-milk

The Corner Garden

in directory

The Corner Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

The Country Store at Apple Country Farm Market

in directory

The Country Store at Apple Country Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

The Farm at Trinity Health - Ann Arbor

📍 5557 McAuley Drive, Ypsilanti, MI, 48197

in directory

The Farm at Trinity Health - Ann Arbor — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Farm Market

📍 State Route 95, Mount Gilead, OH, 43338

in directory

The Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Farm on Jennings

📍 Ann Arbor, MI, 48105

in directory

The Farm on Jennings — a Certified Naturally Grown produce and flowers operation in Ann Arbor, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

The Farmer's Daughter Farm & Flowers

in directory

The Farmer's Daughter Farm & Flowers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

The Fruit Bowl

📍 8767 E Waterloo Road, Stockton, CA, 95215

in directory

The Fruit Bowl — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Garden

📍 Petersburg, 99833

in directory

The Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

The Hollow

in directory

The Hollow — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Homestead Aronia Plantation

📍 Stromsburg, NE, 68666

in directory

The Homestead Aronia Plantation — a Certified Naturally Grown produce and flowers operation in Stromsburg, NE. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

The Honey Stand

in directory

The Honey Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

The Indian Agro Development Company

📍 Rajasthan, India

in directory

The Indian Agro Development Company — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

The Lavender Garden

in directory

The Lavender Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

The Lawrence Place

📍 Carey Road, Findlay, OH, 45840

in directory

The Lawrence Place — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Market

📍 16511 Northwest Gillihan Road, Portland, OR, 97231

in directory

The Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Michigan Urban Farming Initiative

in directory

The Michigan Urban Farming Initiative — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Milkhouse

in directory

The Milkhouse — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

The Moon Farm

📍 Clarksville, GA, 30523

in directory

The Moon Farm — a Certified Naturally Grown produce and flowers operation in Clarksville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

The Old Gray Mare

📍 5678 Soco Road, Maggie Valley, NC, 28751

in directory

The Old Gray Mare — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Orchard

in directory

The Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

The Orchard at Altapass

📍 1025 Orchard Road, Spruce Pine, NC, 28777

in directory

501(c)(3) preservation orchard on the Blue Ridge Parkway in Spruce Pine, NC, with heirloom apple trees nearing 100 years old. The Altapass Foundation propagates heritage varieties 'with the least chemicals,' maintains pollinator and wetland habitat, and runs live music, storytelling, and Appalachian education programming.

orchardheirloom-applesnonprofit-501c3pollinator-habitat

The Orchard Kitchen

in directory

The Orchard Kitchen — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

The Original Manassero Farms

📍 Rose Drive, Brea, CA, 92823

in directory

The Original Manassero Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

The Peachman

📍 Four Oaks, NC, 27524

in directory

The Peachman — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Pumpkin Factory

in directory

The Pumpkin Factory — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

The Pumpkin Patch

in directory

The Pumpkin Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

The Pumpkin Peddler

in directory

The Pumpkin Peddler — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

The Purple Martin Farm

📍 Angier, NC, 27501

in directory

The Purple Martin Farm — a Certified Naturally Grown produce and flowers operation in Angier, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

The Shafer Farm LLC

📍 9800 Hartline Road

in directory

The Shafer Farm LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Shed at Cooley Farm

📍 3097 Highway 11 West, Chesnee, SC, 29323

in directory

The Shed at Cooley Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Soil Ministry

📍 Hull, GA, 30646

in directory

The Soil Ministry — a Certified Naturally Grown produce and flowers operation in Hull, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

The Sower's Row LLC (dba The Sowers' Row)

📍 Maidens, VA, 23102

in directory

The Sower's Row LLC (dba The Sowers' Row) — a Certified Naturally Grown produce and flowers operation in Maidens, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

The Sweetbriar Farm

in directory

The Sweetbriar Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Table Farm and Workshop

📍 Bloomington, IL, 61705

in directory

The Table Farm and Workshop — a Certified Naturally Grown produce and flowers operation in Bloomington, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

The Tomato Barn

📍 65 Penn Street, Washington Boro, PA, 17582

in directory

The Tomato Barn — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

The Tomato Stand

in directory

The Tomato Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

The Williams Farm of ALT

📍 ATHENS, GA, 30601

in directory

The Williams Farm of ALT — a Certified Naturally Grown produce and flowers operation in ATHENS, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

The Wilson Farms North Augusta

📍 600 West Martintown Road, North Augusta, SC, 29841

in directory

The Wilson Farms North Augusta — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

The Woven Farmstead

📍 Whitehall, MI, 49461

in directory

The Woven Farmstead — a Certified Naturally Grown produce and flowers operation in Whitehall, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Theisen's

in directory

Theisen's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Theo's Market Gardens

📍 571 Great Road

in directory

Theo's Market Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Third Street Apples Orchard & Store

📍 935 3rd Street, Penrose, CO, 81240

in directory

Third Street Apples Orchard & Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Thistle Hut

in directory

Thistle Hut — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Thistledown Farm Market

📍 91455 River Road

in directory

Family-run Willamette Valley farm growing 75+ vegetable and fruit crops, U-cut flowers, and free-range grass-fed beef for over fifty years on River Road.

vegetable-farmflower-farmgrass-fedmulti-generational

Thompson Orchards, Inc.

📍 4303 US-701, Four Oaks, NC, 27524

in directory

Thompson Orchards, Inc. — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Thompson's Farm Market

📍 9950 US 12, Naches, WA, 98937

in directory

Thompson's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Thompson's Orchard

in directory

Thompson's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Thornfield Farm

📍 Fincastle, VA, 24090

in directory

Thornfield Farm — a Certified Naturally Grown produce and flowers operation in Fincastle, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Thornton River Orchard & Market

in directory

Thornton River Orchard & Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Thunder Road Farm

in directory

Thunder Road Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Thunderfoot Farms

📍 Paw Paw, MI, 49079

in directory

Thunderfoot Farms — a Certified Naturally Grown livestock operation in Paw Paw, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Tiemeyer's Farm Market

📍 3147 South County Road 300 West, Vallonia, IN, 47281

in directory

Tiemeyer's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Tigges Farms

📍 12404 County Road 64 1/2, Greeley, CO, 80631

in directory

Tigges Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

TIKAU PRAKARTIK KHETI EVAM UTPAD KALYAN SAMITI

in directory

TIKAU PRAKARTIK KHETI EVAM UTPAD KALYAN SAMITI — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Tinker's Summer Kitchen

📍 1317 Roosevelt Road, Niagara, WI, 54151

in directory

Tinker's Summer Kitchen — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Tiny Bridge Farm

📍 Hendersonville, NC, 28792

in directory

Tiny Bridge Farm — a Certified Naturally Grown produce and flowers operation in Hendersonville, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

TJ's Farm Market & Cafe

in directory

TJ's Farm Market & Cafe — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

TJ's Market

📍 4919 Genoa Road, Belvidere, IL, 61008

in directory

TJ's Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Today’s Harvest

in directory

Today’s Harvest — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Todd Geisert Farms

📍 4851 Old Highway 100, Washington, MO, 63090

in directory

Todd Geisert Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Tom's Bee Happy Honey

in directory

Tom's Bee Happy Honey — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Tomato Sunshine Garden Center & Farm Market

in directory

Tomato Sunshine Garden Center & Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Top Quality Live Poultry

📍 131-62 Avery Avenue, Flushing, NY, 11355

in directory

Top Quality Live Poultry — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedpoultry-farm

Tortoise & Hare Farm

📍 Muskegon, MI, 49445

in directory

Tortoise & Hare Farm — a Certified Naturally Grown produce and flowers operation in Muskegon, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Tougas Family Farm Store

in directory

Tougas Family Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Townsend Farms LLC

📍 16342 Highway 550, Aztec, NM, 87410

in directory

Townsend Farms LLC — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Traugers Farm Market

in directory

Traugers Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Traunik Farm

📍 Trenary, MI, 49891

in directory

Traunik Farm — a Certified Naturally Grown produce and flowers operation in Trenary, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Trax Farms Market

📍 528 Trax Road, Finleyville, PA, 15332

in directory

Trax Farms Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Treat From Nature Farm

📍 24921 CR 42, Paisley, FL, 32767-9241

in directory

Treat From Nature Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Tremper Hill Farms

📍 5224 State Highway 28, 12457

in directory

Tremper Hill Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Triangle Acres

in directory

Triangle Acres — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Tribe Country Farms

📍 Woodstock, IL, 60098

in directory

Tribe Country Farms — a Certified Naturally Grown aquaponics operation in Woodstock, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownaquaponicsecologicalsubstrate-builder

Tricka Farm

in directory

Tricka Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Trimble Farms

📍 9274 FM 1795, Big Sandy, TX, 75755

in directory

Trimble Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Trinity Family Farms

📍 717 Trinity Church Road, Mooresboro, NC, 28114

in directory

Trinity Family Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Trinity River Farm

in directory

Trinity River Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Triple A Farm & Market

in directory

Triple A Farm & Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Triple B Farms

📍 823 Berry Lane, Monongahela, PA, 15063

in directory

Triple B Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Triple Cross Acres, LLC

📍 Choctaw, OK, 73020-4913

in directory

Triple Cross Acres, LLC — a Certified Naturally Grown produce and flowers operation in Choctaw, OK. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Triple J Farms

in directory

Triple J Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Triple M Farms

📍 10326 Shawnee Road, Harrington, DE 19952

in directory

A family produce farm in Harrington, Delaware, offering a wide variety of seasonal fruits and vegetables direct to local eaters. Small-scale, phone-ordering operation typical of the family-farm layer that still works the central Delmarva agricultural belt.

produceharringtonkent-countydelaware

Tristan Ranch

in directory

Tristan Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Trout Farm Acres

in directory

Trout Farm Acres — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Trout Run Acres

📍 1055 Reading Avenue, Boyertown, PA, 19512

in directory

A family farm and roadside farm stand on Reading Avenue in Boyertown, PA — eastern Berks County, on the edge of the Schuylkill Valley. Grows vegetables and tomatoes directly on the farm; offers locally-raised butchered meats; produces value-added tomato products including mild salsa, sweet tomato butter, and pasta sauce. Open seasonally, closing October 30 through spring.

vegetabletomatovalue-addedsalsa

True To Our Roots Farm

📍 Ransomville, NY, 14131

in directory

True To Our Roots Farm — a Certified Naturally Grown produce and flowers operation in Ransomville, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Truefarm Foods India Private Limited

📍 Maharashtra, India

in directory

Truefarm Foods India Private Limited — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Trujillo Family Farm

📍 Broomfield, CO, 80023

in directory

Trujillo Family Farm — a Certified Naturally Grown produce and flowers operation in Broomfield, CO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

TRUZT ORGANIC AND NATURAL PRODUCTS

📍 Tamil Nadu, India

in directory

TRUZT ORGANIC AND NATURAL PRODUCTS — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Tsedah Farms

📍 Crystal Lake, IL, 60012

in directory

Tsedah Farms — a Certified Naturally Grown produce and flowers operation in Crystal Lake, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Tubby Creek Farm

📍 Ashland, MS, 38603

in directory

Tubby Creek Farm — a Certified Naturally Grown produce and flowers operation in Ashland, MS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Tuckaway Farm

📍 Bentonville, AR, 72712

in directory

Tuckaway Farm — a Certified Naturally Grown produce and flowers operation in Bentonville, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Tuff's Ranch

📍 5055 South Kiowa-Bennett Road, Bennett, CO, 80102

in directory

Tuff's Ranch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Tulmeadow Farm Store

📍 255 Farms Village Road, West Simsbury, CT, 06092

in directory

Year-round Connecticut farm store in West Simsbury — seasonal CT-grown vegetables, heirloom tomatoes, grass-fed beef, and farm-made ice cream from the on-site dairy.

vegetable-farmgrass-fedice-creamconnecticut

Turkeyfoot Creek Elderberry Farm

📍 Napoleon, OH, 43545

in directory

Turkeyfoot Creek Elderberry Farm — a Certified Naturally Grown produce and flowers operation in Napoleon, OH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Turkeyfoot Farm

📍 LaPorte, IN, 46350

in directory

Turkeyfoot Farm — a Certified Naturally Grown produce and flowers operation in LaPorte, IN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Turnip Rock Farm & Cosmic Wheel Creamery

in directory

Turnip Rock Farm & Cosmic Wheel Creamery — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

Turnip Rock Farm & Cosmic Wheel Creamery

📍 260 95th Street, Clear Lake, WI, 54005

in directory

An integrated organic farm and artisan creamery operating as a 'whole farm ecosystem' in Clear Lake, WI. Low-till organic vegetables, 100% grass-fed beef cattle, pastured whey-fed pork, and 100% grass-fed dairy cows that supply the on-farm creamery. Cosmic Wheel Creamery (added 2015) produces raw-milk aged cheeses, fresh curds, and spreadable herbed cheese. Vegetable CSA ran for 14 years and ended 2023; vegetables now sold via farm store, farmers markets (Mill City, St. Croix Falls), select retail, and online farm stand.

certified-organiclow-tillgrass-fedwhey-fed-pork

Turtle Gulch Gardens LLC

📍 Bradleyville, MO, 65614

in directory

Turtle Gulch Gardens LLC — a Certified Naturally Grown produce and flowers operation in Bradleyville, MO. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Turtle Rock Farm

📍 Maine

in directory

Maine preservation farm turning local and organic fruits and vegetables into traditionally preserved pantry goods — four-time Good Food Awards finalist and Slow Food USA member.

vegetable-farmpreservesorganicgood-food-awards

Tuttle Orchard

📍 5717 North 300 W, Greenfield, IN, 46140

in directory

Tuttle Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Twelve Hands Farm

📍 Falmouth, ME, 04105

in directory

Twelve Hands Farm — a Certified Naturally Grown apiary operation in Falmouth, ME. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Two Finger Farms

📍 310 Stoker Drive, Saginaw, MI, 48604-2331

in directory

Two Finger Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Two Stones Farm

📍 1060 Main Street, Fleischmanns, NY, 12430

in directory

Two Stones Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifieddairy

U City Farmers

📍 6655 Delmar Boulevard, 63130

in directory

U City Farmers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

U-Pick -- Farm Fresh

📍 650 Highway 30, Peter, Utah

in directory

U-Pick -- Farm Fresh — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

UNICORN NATURAL PRODUCTS PRIVATE LIMITED

📍 Telangana, India

in directory

UNICORN NATURAL PRODUCTS PRIVATE LIMITED — an NPOP-certified organic operator in Telangana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatelangana

Unicorn Nutrition Private Limited

📍 Telangana, India

in directory

Unicorn Nutrition Private Limited — an NPOP-certified organic operator in Telangana, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatelangana

Union Orchard

in directory

Union Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Up Beet Farm LLC

📍 Prairie du Sac, WI, 53578

in directory

Up Beet Farm LLC — a Certified Naturally Grown produce and flowers operation in Prairie du Sac, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Up Country Farm

📍 36W465 Huntley Road, West Dundee, IL, 60118

in directory

Up Country Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Upperlevel Concession Stand

in directory

Upperlevel Concession Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Ups and Downs Farm

📍 Franklin, GA, 30217

in directory

Ups and Downs Farm — a Certified Naturally Grown produce and flowers operation in Franklin, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Urban Tree Harvest Farmstand

📍 608 North 54th Street, Philadelphia, 19131

in directory

Urban Tree Harvest Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Urbandale Farm

in directory

Urbandale Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

USU Student Organic Farm CSA

📍 1750 North 800 East, UT

in directory

USU Student Organic Farm CSA — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

UTTRAY GAYZING GROWER GROUP (SBOR13SKWSUG)

📍 Sikkim, India

in directory

UTTRAY GAYZING GROWER GROUP (SBOR13SKWSUG) — an NPOP-certified organic operator in Sikkim, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasikkim

VAIGAH FARMER PRODUCER COMPANY LIMITED

📍 Tamil Nadu, India

in directory

VAIGAH FARMER PRODUCER COMPANY LIMITED — an NPOP-certified organic operator in Tamil Nadu, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiatamil-nadu

Valcarce Farms

in directory

Valcarce Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Valhalla Farms Wellness

📍 250 Magnolia Avenue, Winter Haven, FL

in directory

Valhalla Farms Wellness — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedgrain-farm

Valley Dream Farm

📍 5901 Pleasant Valley Road, Cambridge, VT, 05444

in directory

A certified-organic diversified vegetable and flower farm on Pleasant Valley Road in Cambridge, Vermont — Champlain Valley / Lamoille County. Operating since 1992, evolved from a dairy farm to a multi-generation organic vegetable operation with CSA, on-farm farmstand, annual flower starts, and weekly farm-to-table dinners (June–October). Conservation-protected through the Vermont Land Trust.

certified-organicdiversified-vegetablecsafarm-stand

Valley Pike Farm Market

📍 3494 Lee Highway, Weyers Cave, VA, 24486

in directory

Valley Pike Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Valley View Farm

📍 16 Walpole Road, Haydenville, MA, 01039

in directory

Valley View Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Vallon Farmdirect Private Limited

📍 Rajasthan, India

in directory

Vallon Farmdirect Private Limited — an NPOP-certified organic operator in Rajasthan, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiarajasthan

VanAntwreps Farm Market

in directory

VanAntwreps Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

VATTAM AGRO & DAIRY INDUSTRIES PRIVATE LIMITED

in directory

VATTAM AGRO & DAIRY INDUSTRIES PRIVATE LIMITED — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Veggies, Flowers, & More

in directory

Veggies, Flowers, & More — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedflower-farm

Vendedor de frutas

📍 Calle Marginal Baldorioty de Castro, San Juan, PR

in directory

Vendedor de frutas — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Vernon Family Farm

📍 301 Piscassic Road, Newfields, NH, 03856

in directory

Vernon Family Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Verrill Farm

📍 11 Wheeler Road, Concord, MA, 01742

in directory

Verrill Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Vertical Grows

📍 4306 Bryant Avenue South, Minneapolis, MN, 55409

in directory

Vertical Grows — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Vest Berries

in directory

Vest Berries — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Vibrant Farm

📍 Bantam, CT, 06750

in directory

Vibrant Farm — a Certified Naturally Grown produce and flowers operation in Bantam, CT. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

VIGAR ENTERPRISES PRIVATE LIMITED

in directory

VIGAR ENTERPRISES PRIVATE LIMITED — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Vila Verde Farm

in directory

Vila Verde Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Village market

in directory

Village market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Villines Farm

📍 Ponca, AR, 72670

in directory

Villines Farm — a Certified Naturally Grown produce and flowers operation in Ponca, AR. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Vinnie's Farm Market

in directory

Vinnie's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Vintage Prairie Farm

📍 Burlington, WI, 53105

in directory

Vintage Prairie Farm — a Certified Naturally Grown produce and flowers operation in Burlington, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Virginia Carolina Enterprises

📍 16125 Fancy Gap Highway, Cana, VA, 24317

in directory

Virginia Carolina Enterprises — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Virginia Farm Market

📍 1881 North Frederick Pike, Winchester, VA, 22603

in directory

Virginia Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Vision Produce Company

📍 1055 North 71st Avenue, Phoenix, AZ, 85043

in directory

Vision Produce Company — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Viva Fruits & Vegetables

in directory

Viva Fruits & Vegetables — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Vriddhi Agri Foods Products Private Limited

📍 Karnataka, India

in directory

Vriddhi Agri Foods Products Private Limited — an NPOP-certified organic operator in Karnataka, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakarnataka

Wag Valley Farm

in directory

Wag Valley Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Wahmhoff Farms Nursery

📍 22330 M-40 Hwy, Gobles, MI, 49055

in directory

Wahmhoff Farms Nursery — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

Waialua Farmer’s Market

in directory

Waialua Farmer’s Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wake Robin Farm

in directory

Wake Robin Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

WALERIA HEALTHTECH PRIVATE LIMITED

in directory

WALERIA HEALTHTECH PRIVATE LIMITED — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Walker Creek Farm

in directory

Walker Creek Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Walker's Apiary

📍 Newark, DE, 19711

in directory

Walker's Apiary — a Certified Naturally Grown apiary operation in Newark, DE. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Walnut Hill Community Garden

in directory

Walnut Hill Community Garden — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Walnut Hill Farmstand

📍 4610 Market Street, Philadelphia, 19139

in directory

Walnut Hill Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Wannabe Farms

📍 Barnesville, GA, 30204

in directory

Wannabe Farms — a Certified Naturally Grown livestock operation in Barnesville, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Wards Farm Market

in directory

Wards Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Warwick Furnace Farm

📍 Glenmoore, PA, 19343

in directory

Warwick Furnace Farm — a Certified Naturally Grown produce and flowers operation in Glenmoore, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Waseda Farms Market

📍 7281 Logerquist Road, 54202

in directory

Wisconsin/Missouri family livestock operation producing organic-certified grass-fed beef and organic poultry, plus non-GMO pork — no antibiotics, no added hormones. Stated mission: 'raise the same high-quality food we feed our five kids.'

livestock-farmorganic-certifiedgrass-fednon-gmo

Wasem Fruit Farm

in directory

Wasem Fruit Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wasson Farm

📍 2545-B Shingletown Road, State College, PA, 16801

in directory

Wasson Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Watatic Farm

📍 9 Rindge State Road

in directory

Watatic Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Water Wheel Farms

in directory

Water Wheel Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wayanad Agriculture Society

📍 Kerala, India

in directory

Wayanad Agriculture Society — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

WAYANAD GRAMA VIKAS FARMERS PRODUCER COMPANY LIMITED

in directory

WAYANAD GRAMA VIKAS FARMERS PRODUCER COMPANY LIMITED — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Wayne 'Buddy' Taylor

in directory

Wayne 'Buddy' Taylor — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

We Olive

📍 1311 Park Street

in directory

We Olive — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Weaver's Way Farmstand

📍 Philadelphia, 19119

in directory

Weaver's Way Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Weavers Way Co‑op - Chestnut Hill

📍 8424 Germantown Avenue, Philadelphia, PA, 19118

in directory

Weavers Way Co‑op - Chestnut Hill — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Webb Family Farm

📍 Buffalo Mills, PA, 15534-8113

in directory

Webb Family Farm — a Certified Naturally Grown produce and flowers operation in Buffalo Mills, PA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Webb's Orchard

📍 1110 Old State Highway 18, Lawndale, NC, 28090

in directory

Webb's Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Weber's Cider Mill Farm

📍 2526 Proctor Lane, Parkville, MD, 21234

in directory

Weber's Cider Mill Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Weber's Peachberry Farm

📍 11409 Harford Road, Glen Arm, MD, 21057

in directory

Weber's Peachberry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Weiser Farm Market

in directory

Weiser Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Welch's Farm Market

in directory

Welch's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wellsmere Farm

in directory

Wellsmere Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wellspring Forest Farm

📍 Trumansburg, NY, 14886-9688

in directory

Wellspring Forest Farm — a Certified Naturally Grown mushrooms operation in Trumansburg, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownmushroomsecologicalsubstrate-builder

Wendi's Sunset Lavender, LLC

📍 Traverse City, MI, 49696

in directory

Wendi's Sunset Lavender, LLC — a Certified Naturally Grown produce and flowers operation in Traverse City, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Wendy Town Farms

📍 146 Gheradi Road, Pike, NH, 03780

in directory

Wendy Town Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wenger's Farm Store

in directory

Wenger's Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wenninghoff's

📍 6707 Wenninghoff Road, Omaha, NE, 68122

in directory

Wenninghoff's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wertz's Farm Market

in directory

Wertz's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

West Brook Tree Farm

in directory

West Brook Tree Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedchristmas-tree-farm

WESTERN INDIA CASHEW CO PVT LTD

📍 Kerala, India

in directory

WESTERN INDIA CASHEW CO PVT LTD — an NPOP-certified organic operator in Kerala, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiakerala

Western India Cashew Co.Pvt.Ltd

in directory

Western India Cashew Co.Pvt.Ltd — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

Western World Farm & Pet

in directory

Western World Farm & Pet — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Westward Farms

📍 242 Westward Road, Stony Point, NC, 28678

in directory

Westward Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Westward Orchards Farm Store

📍 178 Massachusetts Avenue, Harvard, MA, 01451

in directory

Westward Orchards Farm Store — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Wet Knot Farms

📍 Marietta, SC, 29661

in directory

Wet Knot Farms — a Certified Naturally Grown produce and flowers operation in Marietta, SC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Wet Wood Farm, LLC

📍 Goshen, OH, 45122

in directory

Wet Wood Farm, LLC — a Certified Naturally Grown produce and flowers operation in Goshen, OH. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Wheeler Farm

in directory

Wheeler Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wheeler's Farm Market

in directory

Wheeler's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Whidbey Farm & Market

📍 1422 N Monroe Landing Rd, Oak Harbor, WA, 98277

in directory

Whidbey Farm & Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Whispering Pines Fruit Farm

📍 76 Orchard Hill Road, Mount Pleasant Mills, PA, 17853

in directory

Whispering Pines Fruit Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

White Diamond Organics, LLC

📍 Waterloo, IL, 62298

in directory

White Diamond Organics, LLC — a Certified Naturally Grown produce and flowers operation in Waterloo, IL. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

White Feather Farm

📍 Saugerties, NY, 12477

in directory

White Feather Farm — a Certified Naturally Grown produce and flowers operation in Saugerties, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

White Gate Farm

in directory

White Gate Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

WHITE GOLD GROWER GROUP

in directory

WHITE GOLD GROWER GROUP — an NPOP-certified organic operator in India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiasubstrate-builder

White Lake Blueberry Farm

📍 7955 US-701, Elizabethtown, NC, 28337

in directory

White Lake Blueberry Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

White Lotus Farms

in directory

White Lotus Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

White Oak Lavendar Farm

📍 2644 Cross Keys Road

in directory

White Oak Lavendar Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

White Oak Pastures

3,200 ac

📍 Bluffton, Georgia, USA (Early County)

in directory

A 3,200-acre, fifth-generation Georgia farm transformed by Will Harris in the 1990s from a conventional cattle operation into one of the most-studied multi-species regenerative systems in North America — ten species across rotated pastures, on-farm USDA-inspected red-meat and poultry abattoirs, and the rare working example of full vertical integration at meaningful scale. A 2019 LCA found the farm's grass-finished beef to be net carbon-negative.

regenerativemulti-speciesrotational-grazinggeorgia

White Oak Point Farm

in directory

White Oak Point Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

White's Farm Market

📍 2180 State Route 64, Bloomfield, NY, 14469

in directory

White's Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Whites Country Farmstand

in directory

Whites Country Farmstand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Who Knows? Farm

📍 19235 US Highway 285, Nathrop, CO, 81236

in directory

Who Knows? Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Whymss Farm

📍 Carlton, GA, 30627

in directory

Whymss Farm — a Certified Naturally Grown produce and flowers operation in Carlton, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Wickham's Fruit Farm

📍 28700 Main Road, Cutchogue, NY, 11935

in directory

Wickham's Fruit Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wilbert's Blueberry Patch

in directory

Wilbert's Blueberry Patch — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedberry-farm

Wilcox Farms

📍 1134 Reading Avenue, Boyertown, PA, 19512

in directory

Wilcox Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Wild Carrot Farm;Fair Winds Farm

in directory

Wild Carrot Farm;Fair Winds Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wild Country Maple Products

📍 191 Barker Lake Road, Lutsen, MN

in directory

Wild Country Maple Products — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedmaple-sugarbush

Wild Scallions Farm

📍 Timberlake, NC, 27583

in directory

Wild Scallions Farm — a Certified Naturally Grown produce and flowers operation in Timberlake, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Wild Thyme Farm

📍 Waterville, NS, B0P 1V0

in directory

Wild Thyme Farm — a Certified Naturally Grown produce and flowers operation in Waterville, NS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Wildberry Acres

📍 Brookfield, MA, 01506

in directory

Wildberry Acres — a Certified Naturally Grown produce and flowers operation in Brookfield, MA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Wilkinsburg Thursday Market

in directory

Wilkinsburg Thursday Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Williams Farm Market

📍 1381 NC-343, South Mills, NC, 27976

in directory

Williams Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Williams Market

📍 28474 Nanticoke Road, 21801

in directory

Williams Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Willing Hands farm

in directory

Willing Hands farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Willow Bend Farm

in directory

Willow Bend Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Willow Haven Farm

📍 7686 Herber Road, New Tripoli, PA (Lehigh Valley)

in directory

Willow Haven Farm is a regenerative DeMaster-family operation in New Tripoli, PA (Lehigh Valley), founded 2009. Vegetables, grass-fed meat, pastured eggs; USDA-Organic certified 2022–2024 (currently uncertified, methods continue); customizable subscription boxes and on-farm + Breinigsville retail.

vegetable-farmlivestock-farmregenerativesoil-building

Willow Moon Farm

📍 Gore, VA, 22637

in directory

Willow Moon Farm — a Certified Naturally Grown produce and flowers operation in Gore, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Willswood Apiaries

📍 LaCrosse, WI, 54601

in directory

Willswood Apiaries — a Certified Naturally Grown apiary operation in LaCrosse, WI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownapiaryecologicalsubstrate-builder

Wilson Farm Market

📍 2747 Hardwick Street, Greensboro, VT, 05841

in directory

Wilson Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedherb-farm

Wilson's Farm

📍 301 Wilson Farm Ln, Yorktown, VA, 23693

in directory

Wilson's Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wind Hill Community Farm

📍 3006 Hebron avenue, Glastonbury, CT, 06033

in directory

Wind Hill Community Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Winding Stair Farm

📍 Franklin, NC, 28734

in directory

Winding Stair Farm — a Certified Naturally Grown produce and flowers operation in Franklin, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Windmill Farm Market

in directory

Windmill Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Windy Brow Farms

📍 359 Ridge Road, Fredon Township, NJ 07860

in directory

A diversified Sussex County, NJ orchard — 45+ apple varieties, 15+ peach varieties, an on-site bakery using regional organic flour, fresh-made ice cream from local ingredients, pick-your-own, and seasonal pizza nights. Substrate-builder and circulator rolled together at the Kittatinny edge of the bioregion.

orchardapplesbakerypick-your-own

Windy Springs Farm

in directory

Windy Springs Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wine Valley Farm

in directory

Wine Valley Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Winney's Bluberry Stand

in directory

Winney's Bluberry Stand — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Winter Sister Farm

in directory

Winter Sister Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Wise

in directory

Wise — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wise Acres Organic Farm

📍 4701 Hartis Road, Indian Trail, NC 28079 (Wise Acres) + 5503 Poplin Road (The GreenHouse)

in directory

Wise Acres Organic Farm is a USDA-certified organic operation in Indian Trail, NC (Carolina Piedmont). Two sites: the working farm with U-pick strawberries and produce by reservation, plus 'The GreenHouse' with plant sales, outdoor dining, ice cream, and regional goods. Honor-stand farm eggs and school-tour programming.

vegetable-farmcertified-organicusda-organicu-pick

Wise Earth Farm

📍 Kelowna, BC, V1W 2E9

in directory

Wise Earth Farm — a Certified Naturally Grown produce and flowers operation in Kelowna, BC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Within You Farm

📍 1849 Fisher Road, Mechanicsburg, PA, 17055

in directory

Within You Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedapiary

Witten Farm Market

in directory

Witten Farm Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wolfberry Hawthorn Farm

📍 Durham, NC, 27704

in directory

Wolfberry Hawthorn Farm — a Certified Naturally Grown produce and flowers operation in Durham, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Wolfforth Market

📍 8924 County Road 7100, Wolfforth, TX, 79382

in directory

Wolfforth Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wonderful Works Farms

📍 14162 Trick Road, Delton, MI, 49046

in directory

Wonderful Works Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wood's Maple Products

📍 Chateaugay, NY, 12953

in directory

Wood's Maple Products — a Certified Naturally Grown produce and flowers operation in Chateaugay, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Woodland Farm

📍 558 Woodland Street, Glastonbury, CT, 06073

in directory

Woodland Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Woodsong Farm

📍 Chattahoochee Hills, GA, 30268

in directory

Woodsong Farm — a Certified Naturally Grown livestock operation in Chattahoochee Hills, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownlivestockecologicalsubstrate-builder

Woolf Farms Market

in directory

Woolf Farms Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Working Aussies Homestead LLC

📍 Dunn, NC, 28334

in directory

Working Aussies Homestead LLC — a Certified Naturally Grown produce and flowers operation in Dunn, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Works Urban Farms

📍 Memphis, TN, 38104

in directory

Works Urban Farms — a Certified Naturally Grown produce and flowers operation in Memphis, TN. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Worth the Wait Farm

📍 52 Bush Row Road, Denmark, ME, 04022

in directory

Worth the Wait Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wright's Farm & Market

📍 699 ny-208

in directory

Five-generation family orchard operating since 1904 in Gardiner, NY. Year-round farm market, pick-your-own apples, on-site bakery, and a farm brewery producing beer, hard cider, wine, and spirits from the operation's fruit.

orchardmulti-generationalheritage-operationpick-your-own

Wronski Family Farm

📍 Appleton, NY, 14008

in directory

Wronski Family Farm — a Certified Naturally Grown produce and flowers operation in Appleton, NY. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

WSU Eggert Family Organic Farm

in directory

WSU Eggert Family Organic Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

WY fresh

📍 200 Walterscheid Boulevard, Cheyenne, WY, 82007-2352

in directory

WY fresh — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Wyldmoon Farm

📍 1403 Lower Elgin Road, Elgin, TX, 78621-5749

in directory

Wyldmoon Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedlivestock-farm

Wylin Grayson Farms

in directory

Wylin Grayson Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Ya Ya Farm & Orchard

in directory

Ya Ya Farm & Orchard is a Goss-family u-pick orchard in Boulder County, CO, on the same 8 acres since 1896 — 130 years of family stewardship. ~1,000 trees: apples primarily plus cherry, plum, pear, grapes, blackberries, and raspberries. Natural and sustainable methods (not USDA-certified).

orchardu-pickmulti-generationallineage-authorized

Yaasies Nest

📍 Riverdale, GA, 30296

in directory

Yaasies Nest — a Certified Naturally Grown produce and flowers operation in Riverdale, GA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Yagerville Farms

📍 22085 Southwest 65th Avenue, Tualatin, OR, 97062

in directory

Yagerville Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

YAM COMMODITIES PRIVATE LIMITED

📍 Maharashtra, India

in directory

YAM COMMODITIES PRIVATE LIMITED — an NPOP-certified organic operator in Maharashtra, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiamaharashtra

Yankee Street Market

📍 8491 Yankee Street, Centerville, OH, 45458

in directory

Yankee Street Market — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Yaqui Hideout

📍 Pearce, AZ, 85625

in directory

Yaqui Hideout — a Certified Naturally Grown produce and flowers operation in Pearce, AZ. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Yates Family Orchard

📍 1074 Davis Road, Hinesburg, VT, 05461

in directory

A family-owned apple orchard on Monkton Ridge in Hinesburg, Vermont, with views across the Champlain Valley to the Adirondacks. Grows 28 apple varieties (McIntosh, Honey Crisp, Cortland, Northern Spy, Liberty, Empire, Honey Gold, Golden Russet, Haralson, and more) plus pears, plums, and peaches. Open early September through late October for U-pick. Operates an on-site Orchard Stand selling Vermont specialty products (cheese, raw honey, maple syrup, hard ciders), orchard-pressed cider, hot cider donuts, pies, and Kingdom Creamery creemees — including the signature 'Dreamee' (hot cider donut topped with maple creemee).

orchardu-pickapplesstone-fruit

Yates Heritage Farm

📍 6796 Nelson Road, Longmont, CO, 80503

in directory

A Colorado-registered hemp farm on Nelson Road in Longmont, Front Range Colorado, running trial varieties selected for the local climate — cold-hardy and drought-resistant — and integrating cider-apple agroforestry on the same land. Maintains regenerative practices: pollinator and beneficial-insect habitat, naturally-trapped honeybee swarms managed with minimal intervention. Sells hemp flower, salve, and whole-plant extract direct.

hemp-farmregenerativeagroforestryregional-genetics

Yee’s Orchard

in directory

Yee’s Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Yesteryear Farm

in directory

Yesteryear Farm — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedvegetable-farm

Yokna(patawpha) Bottoms Farm

📍 Oxford, MS, 38655

in directory

Yokna(patawpha) Bottoms Farm — a Certified Naturally Grown produce and flowers operation in Oxford, MS. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Yonderyear Farm

📍 Rockbridge Baths, VA, 24473

in directory

Yonderyear Farm — a Certified Naturally Grown produce and flowers operation in Rockbridge Baths, VA. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Yooper Produce

📍 Bark River, MI, 49807-9713

in directory

Yooper Produce — a Certified Naturally Grown produce and flowers operation in Bark River, MI. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

York Corner Gardens

in directory

York Corner Gardens — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Young's Orchards

in directory

Young's Orchards — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Zena Farmstead

📍 403 Zena Road, Kingston, NY, 12401

in directory

A regenerative working farm at 403 Zena Road in Kingston, NY — pastured meats, poultry, eggs, organic vegetables, plus an in-house fermentation and prepared-foods program (sauerkraut, kimchi, pickles, hot sauce, fresh baguettes). Retail surfaces are a self-serve refrigerator open daily and a Saturday farm stand running May through October, 10 am–2 pm.

regenerative-agricultureorganicrotational-grazingsilvopasture

ZENITH DRINKS PRIVATE LIMITED

📍 Delhi, India

in directory

ZENITH DRINKS PRIVATE LIMITED — an NPOP-certified organic operator in Delhi, India. Certified under India National Programme for Organic Production (APEDA).

npop-certifiedorganicindiadelhi

Zentec Farms

in directory

Zentec Farms — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Zephyr Family Farm

📍 Roxboro, NC, 27574

in directory

Zephyr Family Farm — a Certified Naturally Grown produce and flowers operation in Roxboro, NC. CNG is a grassroots peer-reviewed ecological certification, the values-aligned alternative to USDA Organic for small farms.

certified-naturally-grownproduce-and-flowersecologicalsubstrate-builder

Zerbe Brothers

📍 54321 Highway 2 East, MT

in directory

Zerbe Brothers — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Ziemke's Farm & Glacier Fresh Produce

200 ac

📍 1670 Smith Road, Zillah, WA, 98953

in directory

A family-owned and operated 200-acre farm + wholesale produce distributor in Zillah, WA — Yakima Valley wine and produce country. Founded 1990, 30+ years in operation. Grows, packs, and delivers all produce directly from the farm to local produce stands, independent sellers, and stores across Yakima County and surrounding communities. Also offers mulch delivery, tree grinding, and orchard removal services to neighboring orchards preparing new crops. Open 7 am – 7 pm daily.

produce-distributorfamily-business200-acresince-1990

Zimmerman's

in directory

Zimmerman's — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verified

Zook Orchard

in directory

Zook Orchard — a farm verified in OpenStreetMap. See [[farm]] for the directory's editorial position; this entry may also operate retail surfaces (farm stand, CSA, farmers-market) that should be added as separate relations.

direct-from-farmosm-verifiedorchard

Where I'm going with this

I want this page to eventually hold every operation worth pointing at — pulling from the USDA Organic INTEGRITY Database (~30,000 certified organic farms), USDA Local Food Directories (markets, CSAs, on-farm markets), and OpenStreetMap for places those don't reach. Filter by what they grow, by certification, by location. Find the farms close enough to drive to.

For now I tend the standouts by hand — the farms that already changed how a lot of people think about what's possible. If you know a farm that belongs here, send it to me: 0@0mn1.one.